DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and NR1D2

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_005117.3 Gene:NR1D2 / 9975 HGNCID:7963 Length:579 Species:Homo sapiens


Alignment Length:543 Identity:117/543 - (21%)
Similarity:188/543 - (34%) Gaps:161/543 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQSSEGSPDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRS 65
            |::|:.|...|.:.::.|   ...|..:|.   ||||.|.:||.|||::||:||.|||:|||:::
Human    76 MKTSKSSAPGMTKSHSGV---TKFSGMVLL---CKVCGDVASGFHYGVHACEGCKGFFRRSIQQN 134

  Fly    66 RQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYK--DAM 128
            .||. |..|...|.:.:.:||:|:.||.:||..|||::|||:..|.|:....|..:.|..  ..|
Human   135 IQYK-KCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTM 198

  Fly   129 MGAGEMPQIPAEILMNTAALTGFPGVPM--PMPGLPQ---RAGHHP---------------AHMA 173
            |.:.....:..:.|:.....|..|....  |.|.|.|   ::...|               ||..
Human   199 MNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKD 263

  Fly   174 AF-----QPPPSAAAVLDLSVPRVP---------------------------------------- 193
            .|     |...||.::......|:|                                        
Human   264 TFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIM 328

  Fly   194 HHP------VHQGHHGFFSPTAAYMNALATRALPPTP-------------------------PLM 227
            |:|      :..||...||      ||...|.....|                         |:.
Human   329 HYPNGHAICIANGHCMNFS------NAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMS 387

  Fly   228 AAEHIKETAAEH-------------LFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQ 279
            .:.::....:.|             :.:.|.:.|.:..|.:|...||:.||:....|..::..|.
Human   388 KSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFAS 452

  Fly   280 YLMPMNFAQLLFV----YESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFR 340
             |.......:.|:    |..::.:....|.:...:..|.|.||.   |.:...|.....|:.|  
Human   453 -LFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNA---LQLSDEEMSLFTAVVL-- 511

  Fly   341 KSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPM 405
                                       .||:..|:.....|.|:......||...|.:.||::..
Human   512 ---------------------------VSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEAS 549

  Fly   406 RFQTLLGVVQLMHKVSSFTIEEL 428
            .|..||..:..:..:::...|||
Human   550 IFTKLLLKLPDLRSLNNMHSEEL 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 42/91 (46%)
NR_LBD 215..436 CDD:416257 42/256 (16%)
NR1D2NP_005117.3 Modulating 1..99 6/25 (24%)
Required for phosphorylation by CSNK1E and cytoplasmic localization. /evidence=ECO:0000250|UniProtKB:Q60674 1..60
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..61
NR_DBD_REV_ERB 98..186 CDD:143540 41/91 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..250 6/27 (22%)
NR_LBD_REV_ERB 389..577 CDD:132738 39/217 (18%)
Interaction with ZNHIT1. /evidence=ECO:0000269|PubMed:17892483 397..579 39/209 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.