DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and NR1H4

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001193922.1 Gene:NR1H4 / 9971 HGNCID:7967 Length:486 Species:Homo sapiens


Alignment Length:411 Identity:91/411 - (22%)
Similarity:146/411 - (35%) Gaps:108/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQ 87
            |::.||.....|.||.|.:||.||....|:||.|||:|||.::..|.||:  .|.||:|...|.:
Human   126 ASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKN--GGNCVMDMYMRRK 188

  Fly    88 CRACRLRKCFEVGMNKDAVQ----HERGPRNSTLRRHMAMYKDAMMG----AGEMPQIPA----- 139
            |:.||||||.|:||..:.:.    .|...::..||:::..:.|..:.    ..::.|:.:     
Human   189 CQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSC 253

  Fly   140 ----EILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLD-LSVPRVPHHPVHQ 199
                |:..:...|..|                                ::| .:..|:|....::
Human   254 REKTELTPDQQTLLHF--------------------------------IMDSYNKQRMPQEITNK 286

  Fly   200 GHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLL 264
            .....||   |..|.|.               :.|.|..|:...|.:.|.:..|..|...||:.|
Human   287 ILKEEFS---AEENFLI---------------LTEMATNHVQVLVEFTKKLPGFQTLDHEDQIAL 333

  Fly   265 LEESWKEFFILAMAQYL---MPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNID 326
            |:.|..|...|..|:..   :|...:.||   |....|..|.......:.:|.:.:.:   |.:.
Human   334 LKGSAVEAMFLRSAEIFNKKLPSGHSDLL---EERIRNSGISDEYITPMFSFYKSIGE---LKMT 392

  Fly   327 STEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSA 391
            ..||..|.||.:.                             |.:.:.:.:...|..:.......
Human   393 QEEYALLTAIVIL-----------------------------SPDRQYIKDREAVEKLQEPLLDV 428

  Fly   392 LHNYIQRTHPSQPMRFQTLLG 412
            |....:...|..|..|..|||
Human   429 LQKLCKIHQPENPQHFACLLG 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 38/95 (40%)
NR_LBD 215..436 CDD:416257 38/201 (19%)
NR1H4NP_001193922.1 NR_DBD_FXR 134..221 CDD:143520 36/88 (41%)
NR_LBD_Fxr 261..481 CDD:132734 47/274 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.