DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and NR1I3

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_005245750.1 Gene:NR1I3 / 9970 HGNCID:7969 Length:429 Species:Homo sapiens


Alignment Length:382 Identity:87/382 - (22%)
Similarity:131/382 - (34%) Gaps:105/382 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RRSRQYVCKS-----QKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMA 122
            :|||:.|.||     ...|.|.|.||.|..|.||||:||.:.||.||.:.....   ..|||   
Human   105 KRSRRTVSKSIGPTCPFAGSCEVSKTQRRHCPACRLQKCLDAGMRKDMILSAEA---LALRR--- 163

  Fly   123 MYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAA-------FQPPPS 180
                |........|.|.::......|            :....|.|..||..       |:||..
Human   164 ----AKQAQRRAQQTPVQLSKEQEEL------------IRTLLGAHTRHMGTMFEQFVQFRPPAH 212

  Fly   181 AAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVN 245
            ..         :.|.|:         ||           |.|..||:.  |..:.....:.:.:.
Human   213 LF---------IHHQPL---------PT-----------LAPVLPLVT--HFADINTFMVLQVIK 246

  Fly   246 WIKSVRAFTELPMPDQLLLLEESWKEF--FILAMAQYLMPMNFAQLLFVYESENANREIMGMVTR 308
            :.|.:..|..||:.||:.||:.:..|.  .:|.....|...||......|..|:..|     |:.
Human   247 FTKDLPVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGAR-----VSP 306

  Fly   309 EVHAFQEVLNQLCH-------LNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNS 366
            .|....|.|..|.|       |.:...||..|.|::||..:|             .||       
Human   307 TVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPAP-------------YLT------- 351

  Fly   367 SASAESRGLLESGKVAAMHNDARSALHNYI--QRTHPSQPMRFQTLLGVVQLMHKVS 421
                :..|:.:..::..:..:....|.:||  |:..|.....:..|||::..:..::
Human   352 ----DRPGVTQRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGLLAELRSIN 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 23/58 (40%)
NR_LBD 215..436 CDD:416257 46/218 (21%)
NR1I3XP_005245750.1 NR_DBD_like <108..154 CDD:295381 21/45 (47%)
NR_LBD_PXR_like 178..427 CDD:132732 58/299 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.