DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and NR0B2

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_068804.1 Gene:NR0B2 / 8431 HGNCID:7961 Length:257 Species:Homo sapiens


Alignment Length:304 Identity:64/304 - (21%)
Similarity:102/304 - (33%) Gaps:80/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GHHPAHMAAFQPPPSAAAVLDLSVPRVP----------HHPVHQGHHGFFSPTAAYMNALATRAL 220
            |..|...||.: |....|:|..|:..||          |.||.                      
Human     7 GACPCQGAASR-PAILYALLSSSLKAVPRPRSRCLCRQHRPVQ---------------------- 48

  Fly   221 PPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMN 285
                 |.|.......|.:.|.|.|.:::::.:|.:||..||..||:..|...|:|.:||..:...
Human    49 -----LCAPHRTCREALDVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFE 108

  Fly   286 FAQ----------LLFVYESENANREIMGMVTREVHAFQEV---LNQLCHLNIDSTEYECLRAIS 337
            .|:          ||....|...:.::.......:.|.|.:   |.....|.:...||.||:...
Human   109 VAEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTI 173

  Fly   338 LFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPS 402
            ||....|                             ||..:..:..:..:|...|...::...|:
Human   174 LFNPDVP-----------------------------GLQAASHIGHLQQEAHWVLCEVLEPWCPA 209

  Fly   403 QPMRFQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
            ...|...:|.....:..:.:..:.:||||..|||:.|..|:.||
Human   210 AQGRLTRVLLTASTLKSIPTSLLGDLFFRPIIGDVDIAGLLGDM 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537
NR_LBD 215..436 CDD:416257 45/233 (19%)
NR0B2NP_068804.1 NR_LBD_SHP 32..254 CDD:132763 56/278 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.