DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and VDR

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001351014.1 Gene:VDR / 7421 HGNCID:12679 Length:494 Species:Homo sapiens


Alignment Length:502 Identity:99/502 - (19%)
Similarity:177/502 - (35%) Gaps:157/502 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQSSEGSPDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRS 65
            |.:|...||..|...|..|:             |.||.|.::|.|:....|:||.|||:||::|.
Human     4 MAASTSLPDPGDFDRNVPRI-------------CGVCGDRATGFHFNAMTCEGCKGFFRRSMKRK 55

  Fly    66 RQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAV---QHERGPRNSTL-RRHMAMYKD 126
            ..:.|..  .|.|.:.|.:|..|:||||::|.::||.|:.:   :..:..|...| |:.....||
Human    56 ALFTCPF--NGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKD 118

  Fly   127 AMMGAGEMPQIPAE------ILMNTAALTGFPGVPMPMPGLPQRAGHHPAH------MAAFQPP- 178
            ::     .|::..|      ||::                     .||..:      ...|:|| 
Human   119 SL-----RPKLSEEQQRIIAILLD---------------------AHHKTYDPTYSDFCQFRPPV 157

  Fly   179 ---------PSAAAVLDLSVPRVPHHPVHQG-------HHGFFS----PTAAYMNALATRALPPT 223
                     ||.        |...|.|...|       .|...|    .::::.|...:......
Human   158 RVNDGGGSHPSR--------PNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDD 214

  Fly   224 P-------PLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYL 281
            |       .|....|:.:..:..:.|.:.:.|.:..|.:|...||::||:.|..|..:|...:  
Human   215 PSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNE-- 277

  Fly   282 MPMNFAQLLFVYESENANREI-MGMVTREVHAFQEVLNQLC-------HLNIDSTEYECLRAISL 338
               :|......:...|.:.:. :..||:..|:. |::..|.       .||:...|:..|.||.:
Human   278 ---SFTMDDMSWTCGNQDYKYRVSDVTKAGHSL-ELIEPLIKFQVGLKKLNLHEEEHVLLMAICI 338

  Fly   339 FRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQ 403
                                         .|.:..|:.::..:.|:.:...:.|..||:..||..
Human   339 -----------------------------VSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPP 374

  Fly   404 PMRFQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDMYSQR 450
            .                     ..|.:.|.|..:..:|.:::.:|::
Human   375 G---------------------SHLLYAKMIQKLADLRSLNEEHSKQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 30/94 (32%)
NR_LBD 215..436 CDD:416257 38/235 (16%)
VDRNP_001351014.1 NR_DBD_VDR 16..122 CDD:143513 36/125 (29%)
Hinge 97..126 6/33 (18%)
NR_LBD_VDR 124..426 CDD:132731 57/362 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..190 6/39 (15%)
Vitamin D3 binding 227..237 1/9 (11%)
Vitamin D3 binding 271..278 1/11 (9%)
9aaTAD. /evidence=ECO:0000269|PubMed:30468856 416..424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.