DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Nr1i3

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_038947008.1 Gene:Nr1i3 / 65035 RGDID:621400 Length:387 Species:Rattus norvegicus


Alignment Length:418 Identity:90/418 - (21%)
Similarity:149/418 - (35%) Gaps:104/418 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.||.|.::|.|:....|:||.|||:|::.::...:|..  .|.|.|.|..|..|.||||:||..
  Rat    21 CVVCGDRATGYHFHALTCEGCKGFFRRTVSKTIGPICPF--AGRCEVSKAQRRHCPACRLQKCLN 83

  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQ 163
            |||.||.:.....   ..|||.....:.|...:.::.|...|::...                  
  Rat    84 VGMRKDMILSAEA---LALRRARQARRRAQKASLQLSQQQKELIQTL------------------ 127

  Fly   164 RAGHHPAHM-------AAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALP 221
             .|.|..|:       ..|:||....:                 ||..|.|            |.
  Rat   128 -LGAHTRHVGPMFDQFVQFRPPAYLFS-----------------HHRPFQP------------LA 162

  Fly   222 PTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAM--AQYLMPM 284
            |..||:.  |..:.....:.:.:.:.|.:..|..|.|.||:.||:.:..|...:::  ...|...
  Rat   163 PVLPLLT--HFADINTFMVQQIIKFTKDLPLFRSLTMEDQISLLKGAAVEILHISLNTTFCLQTQ 225

  Fly   285 NFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHL--NIDSTEYECLR--------AISLF 339
            ||......|:.|:|           ||....|.|.:|.|  .:.|...|..:        .:.:|
  Rat   226 NFFCGPLCYKMEDA-----------VHGETVVQNTVCTLWYEVWSNGQEAAQPTISHSRVPVRVF 279

  Fly   340 RKSPPSASSTEDLANSSILTGSGSPNSSASAES--------RGLLESGKVAAMHNDARSALHNYI 396
            ....|...:.|.:|         :|.:...|..        .|:.:..::..:..:....|:|:|
  Rat   280 GVDHPLPQNPEKIA---------APGARVCAHGCHGSLLSWPGVTQREEIDQLQEEVALILNNHI 335

  Fly   397 QRTHPSQPMRF--QTLLGVVQLMHKVSS 422
            .........||  ..|:|::..:..::|
  Rat   336 MEQQSRLQSRFLYAKLMGLLAELRSINS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 31/82 (38%)
NR_LBD 215..436 CDD:416257 43/230 (19%)
Nr1i3XP_038947008.1 NR_DBD_VDR_like 21..92 CDD:143531 31/72 (43%)
NR_LBD 116..385 CDD:416257 55/318 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.