DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Nr1h4

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_008763482.1 Gene:Nr1h4 / 60351 RGDID:628831 Length:516 Species:Rattus norvegicus


Alignment Length:415 Identity:91/415 - (21%)
Similarity:149/415 - (35%) Gaps:108/415 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKT 83
            |::.:::.||.....|.||.|.:||.||....|:||.|||:|||.::..|.||:  .|.||:|..
  Rat   152 RMAASSAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKN--GGNCVMDMY 214

  Fly    84 HRNQCRACRLRKCFEVGMNKDAVQ----HERGPRNSTLRRHMAMYKDAMMG----AGEMPQIPA- 139
            .|.:|:.||||||.|:||..:.:.    .|...::..||:::..:.|..:.    ..::.|:.: 
  Rat   215 MRRKCQDCRLRKCREMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTST 279

  Fly   140 --------EILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLD-LSVPRVPHH 195
                    |:.::...|..:                                ::| .|..|:|..
  Rat   280 TKLCREKTELTVDQQTLLDY--------------------------------IMDSYSKQRMPQE 312

  Fly   196 PVHQGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPD 260
            ..::.....||   |..|.|.               :.|.|..|:...|.:.|.:..|..|...|
  Rat   313 ITNKILKEEFS---AEENFLI---------------LTEMATSHVQILVEFTKRLPGFQTLDHED 359

  Fly   261 QLLLLEESWKEFFILAMAQYL---MPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCH 322
            |:.||:.|..|...|..|:..   :|...|.||   |.......|.......:.:|.:.:.:   
  Rat   360 QIALLKGSAVEAMFLRSAEIFNKKLPAGHADLL---EERIRKSGISDEYITPMFSFYKSVGE--- 418

  Fly   323 LNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHND 387
            |.:...||..|.||.:.                             |.:.:.:.:...|..:...
  Rat   419 LKMTQEEYALLTAIVIL-----------------------------SPDRQYIKDREAVEKLQEP 454

  Fly   388 ARSALHNYIQRTHPSQPMRFQTLLG 412
            ....|....:...|..|..|..|||
  Rat   455 LLDVLQKLCKIYQPENPQHFACLLG 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 38/95 (40%)
NR_LBD 215..436 CDD:416257 38/201 (19%)
Nr1h4XP_008763482.1 NR_DBD_FXR 164..251 CDD:143520 36/88 (41%)
NR_LBD_Fxr 292..511 CDD:132734 47/273 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.