DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and RARB

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001277145.1 Gene:RARB / 5915 HGNCID:9865 Length:455 Species:Homo sapiens


Alignment Length:448 Identity:111/448 - (24%)
Similarity:173/448 - (38%) Gaps:121/448 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SEGSPDMMD-QKYNSVRLSPAASSRI---LYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRR 64
            |..||..:: |..:|..|.|:..|.:   ..:.||.||:|.|||.|||:.||:||.|||:|||::
Human    54 STPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQK 118

  Fly    65 SRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMM 129
            :..|.|...|.  ||::|..||:|:.|||:|||||||:|::|:::|..:.....:........| 
Human   119 NMIYTCHRDKN--CVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM- 180

  Fly   130 GAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPH 194
             ..|:..:..:|                          ..||...|                   
Human   181 -TAELDDLTEKI--------------------------RKAHQETF------------------- 199

  Fly   195 HPVHQGHHGFFSPTAAYMNALATRALPPTPPLMAAEH-----------IKETAAEHLFKNVNWIK 248
                        |:...:....|.:        :|:|           ..|.|.:.:.|.|.:.|
Human   200 ------------PSLCQLGKYTTNS--------SADHRVRLDLGLWDKFSELATKCIIKIVEFAK 244

  Fly   249 SVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMP----MNFAQLLFVYESENANREIMGMVTRE 309
            .:..||.|.:.||:.||:.:..:..||.:.....|    |.|:..|.:..::..|.. .|.:|..
Human   245 RLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAG-FGPLTDL 308

  Fly   310 VHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRG 374
            |..|   .|||..|.:|.||...|.||.|.                             ..:.:.
Human   309 VFTF---ANQLLPLEMDDTETGLLSAICLI-----------------------------CGDRQD 341

  Fly   375 LLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTLLGVVQLMHKVSSFTIEELFFRK 432
            |.|..||..:......||..||::..||:|..|..:|..:..:..:|:...|.:...|
Human   342 LEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 44/94 (47%)
NR_LBD 215..436 CDD:416257 53/233 (23%)
RARBNP_001277145.1 Modulating 1..87 8/32 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..78 7/23 (30%)
NR_DBD_RAR 82..166 CDD:143522 43/85 (51%)
Hinge 154..182 4/29 (14%)
NR_LBD_RAR 186..416 CDD:132735 58/312 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.