DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and RARA

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_005257609.1 Gene:RARA / 5914 HGNCID:9864 Length:478 Species:Homo sapiens


Alignment Length:427 Identity:102/427 - (23%)
Similarity:166/427 - (38%) Gaps:119/427 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHR 85
            ||....||  :.||.||:|.|||.|||:.||:||.|||:|||:::..|.|...|.  |:::|..|
Human    93 SPPPLPRI--YKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKN--CIINKVTR 153

  Fly    86 NQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTG 150
            |:|:.|||:|||||||:|::|:::|..:..                 |:|:              
Human   154 NRCQYCRLQKCFEVGMSKESVRNDRNKKKK-----------------EVPK-------------- 187

  Fly   151 FPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNAL 215
                              |....::...|....:::         .|.:.|...| |....:...
Human   188 ------------------PECSESYTLTPEVGELIE---------KVRKAHQETF-PALCQLGKY 224

  Fly   216 ATRALPPTPPLMAAEH-----------IKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESW 269
            .|.        .::|.           ..|.:.:.:.|.|.:.|.:..||.|.:.||:.||:.:.
Human   225 TTN--------NSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAAC 281

  Fly   270 KEFFILAMAQYLMP----MNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEY 330
            .:..||.:.....|    |.|:..|.:..::..|.. .|.:|..|.||   .|||..|.:|..|.
Human   282 LDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAG-FGPLTDLVFAF---ANQLLPLEMDDAET 342

  Fly   331 ECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNY 395
            ..|.||.|.                             ..:.:.|.:..:|..:......||..|
Human   343 GLLSAICLI-----------------------------CGDRQDLEQPDRVDMLQEPLLEALKVY 378

  Fly   396 IQRTHPSQPMRFQTLLGVVQLMHKVSSFTIEELFFRK 432
            :::..||:|..|..:|..:..:..:|:...|.:...|
Human   379 VRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 44/91 (48%)
NR_LBD 215..436 CDD:416257 48/233 (21%)
RARAXP_005257609.1 NR_DBD_RAR 98..182 CDD:143522 44/87 (51%)
NR_LBD_RAR 202..432 CDD:132735 52/265 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.