DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and pgr

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001159807.1 Gene:pgr / 569575 ZFINID:ZDB-GENE-990415-214 Length:617 Species:Danio rerio


Alignment Length:397 Identity:93/397 - (23%)
Similarity:150/397 - (37%) Gaps:90/397 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.:|.|.:||.|||:..|..|..|||.::.....|:|..:..  |:|||..|..|.|||||||::
Zfish   251 CVICGDEASGCHYGVLTCGSCKVFFKTAVEGHHNYLCAGRND--CIVDKIRRKNCPACRLRKCYQ 313

  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQ 163
            .||.....:.:|          .|..|...:....|.|.|..:|.:...|:..|.:         
Zfish   314 AGMMLGGRKMKR----------FAGLKVMGLSPSLMFQSPLSLLTDGQTLSSLPCM--------- 359

  Fly   164 RAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMA 228
                  :.|...|..|...::|:...|:|    |:.|          |.|.      .|..|.:.
Zfish   360 ------SAMRELQLSPQMISILENIEPQV----VYSG----------YDNT------QPEVPHLL 398

  Fly   229 AEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMA----QYLMP--MNFA 287
            ...:.......|...|.|.||:..|..|.:.||:.|::.||....:.::.    |.:.|  :.||
Zfish   399 LNSLNRLCERQLLWIVRWSKSLPGFRNLHINDQMTLIQYSWMGLMLFSLGWRTFQNVTPDYLYFA 463

  Fly   288 QLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSP----PSASS 348
            ..|.:...:.....|..:..    |.|.|..:..:|.:...|:.|::|:.|....|    .|.:.
Zfish   464 PDLVLSNDQLRRSPIYDLCL----AMQFVPQEFANLQVTKEEFLCMKALMLLNTVPLEGLKSQTQ 524

  Fly   349 TEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTLLGV 413
            .:::..:.|...|         ::..|.|.|.||:                  ||  ||..|..:
Zfish   525 FDEMRQNYICELS---------KAIQLKEKGVVAS------------------SQ--RFYHLTKL 560

  Fly   414 VQLMHKV 420
            :..||::
Zfish   561 MDNMHEI 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 31/82 (38%)
NR_LBD 215..436 CDD:416257 44/216 (20%)
pgrNP_001159807.1 Na_K-ATPase <71..>125 CDD:298651
zinc finger DBD 246..316 28/66 (42%)
NR_DBD_GR_PR 247..324 CDD:143546 30/74 (41%)
NR_LBD_PR 370..617 CDD:132759 51/251 (20%)
LBD 404..567 42/195 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.