DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and AgaP_AGAP012222

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_001689249.1 Gene:AgaP_AGAP012222 / 5667949 VectorBaseID:AGAP012222 Length:70 Species:Anopheles gambiae


Alignment Length:57 Identity:20/57 - (35%)
Similarity:33/57 - (57%) Gaps:9/57 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQC 88
            |.|:||.|.:||.|||:::|:||.  ..||...:.::.|     |:|:  ...|::|
Mosquito     9 VLCRVCGDKASGFHYGVHSCEGCK--VSRSATSAARWWC-----GVCL--PIRRSRC 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 20/57 (35%)
NR_LBD 215..436 CDD:416257
AgaP_AGAP012222XP_001689249.1 NR_DBD_like 6..>32 CDD:295381 12/22 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.