powered by:
Protein Alignment tll and AgaP_AGAP012222
DIOPT Version :9
Sequence 1: | NP_524596.1 |
Gene: | tll / 43656 |
FlyBaseID: | FBgn0003720 |
Length: | 452 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001689249.1 |
Gene: | AgaP_AGAP012222 / 5667949 |
VectorBaseID: | AGAP012222 |
Length: | 70 |
Species: | Anopheles gambiae |
Alignment Length: | 57 |
Identity: | 20/57 - (35%) |
Similarity: | 33/57 - (57%) |
Gaps: | 9/57 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 VPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQC 88
|.|:||.|.:||.|||:::|:||. ..||...:.::.| |:|: ...|::|
Mosquito 9 VLCRVCGDKASGFHYGVHSCEGCK--VSRSATSAARWWC-----GVCL--PIRRSRC 56
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.