DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and roraa

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_017209577.1 Gene:roraa / 564951 ZFINID:ZDB-GENE-060306-2 Length:519 Species:Danio rerio


Alignment Length:478 Identity:108/478 - (22%)
Similarity:186/478 - (38%) Gaps:139/478 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKC 96
            :|||:|.|.|||.|||:..|:||.|||:||.:.:..|.|..||.  |::|:|.||:|:.|||:||
Zfish    67 IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNAAYSCPRQKN--CLIDRTSRNRCQHCRLQKC 129

  Fly    97 FEVGMNKDAV------QHERGPRNSTLRRH--MAMYKDAMMGAGEMPQIPAEILMNTAALT---- 149
            ..|||::|||      :.:|....:.:::|  ....:|.....||...:.....::|..||    
Zfish   130 LAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRLQQQQRDHQQQPGEAEPLTPTYGLSTNGLTELHD 194

  Fly   150 ---GFPGVPMPMPGLPQRAGHHP------AHMAAF----QPPPSAAAVLDLSVPRVPHHPV--HQ 199
               |:..            ||.|      :.:::|    ||.|..:.   |.:..:...|:  ..
Zfish   195 DLSGYMN------------GHTPDGTKPDSGVSSFYLDIQPSPDQSG---LDINGIKPEPICDFT 244

  Fly   200 GHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAE-HL---------FKNVNW-------- 246
            ...||| |..::.|...:    ||..:...||:.:..:: |:         .:.:.|        
Zfish   245 PGSGFF-PYCSFTNGETS----PTVSMAELEHLAQNISKSHMETCQYLREELQQMTWQAFLQEEV 304

  Fly   247 -----------------------------IKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLM 282
                                         .|.:..|.||...||::||:....|...:.|.:...
Zfish   305 ENYQSKPREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFVRMCRAFD 369

  Fly   283 PMNFAQLLFVYESENANREIMGMVTRE--VHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPS 345
            |.|..   ..::.:.|..::...:..:  :.:..|....||.:::...|      |:||      
Zfish   370 PQNNT---VYFDGKYAGPDVFKSLGCDDLISSVFEFGKNLCSMHLSEDE------IALF------ 419

  Fly   346 ASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTL 410
                    ::.:|         .||:...|.|..||..:....:.||.:.:|:.|....:     
Zfish   420 --------SAFVL---------MSADRSWLQEKVKVEKLQQKIQLALQHVLQKNHREDGI----- 462

  Fly   411 LGVVQLMHKVSSFTIEELFFRKT 433
              :.:|:.|||  |:..|..|.|
Zfish   463 --LTKLICKVS--TLRALCSRHT 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 41/90 (46%)
NR_LBD 215..436 CDD:416257 45/268 (17%)
roraaXP_017209577.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.