DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nr3c1

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001018547.2 Gene:nr3c1 / 553740 ZFINID:ZDB-GENE-050522-503 Length:746 Species:Danio rerio


Alignment Length:435 Identity:98/435 - (22%)
Similarity:157/435 - (36%) Gaps:95/435 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SPDMMDQKYNSVRLSPAASS---RILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQY 68
            |.:.....|:....|.|.||   :...|..|.||.|.:||.|||:..|..|..||||::.....|
Zfish   357 SKNFSSSPYSRPEDSTATSSAGGKTGTHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNY 421

  Fly    69 VCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGE 133
            :|..:..  |::||..|..|.|||.|||...|||.:|.:.:     |..|:...:.:...:....
Zfish   422 LCAGRND--CIIDKIRRKNCPACRFRKCLMAGMNLEARKSK-----SKARQAGKVIQQQSIPERN 479

  Fly   134 MPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVH 198
            :|.:|     ...||     ||.|||                |..|:..::|....|    ..::
Zfish   480 LPPLP-----EARAL-----VPKPMP----------------QLVPTMLSLLKAIEP----DTLY 514

  Fly   199 QGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLL 263
            .|:......|:..:.....|                .....:...|.|.|::..|..|.:.||:.
Zfish   515 AGYDSTIPDTSVRLMTTLNR----------------LGGRQVISAVKWAKALPGFRNLHLDDQMT 563

  Fly   264 LLEESWKEFFILAMA---QYLMPMNFAQLLFVYESE-NANREIMGMVTREVHAFQEVLNQLCHLN 324
            ||:.||  .||::..   :.....|...|.|..:.. |..|..:..::.:.....::.|:...|.
Zfish   564 LLQCSW--LFIMSFGLGWRSYQHCNGNMLCFAPDLVINEERMKLPYMSDQCEQMLKISNEFVRLQ 626

  Fly   325 IDSTEYECLRAISLFRKSP----PSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMH 385
            :.:.||.|::.:.|....|    .|.|..::|..|.|                  .|.||.....
Zfish   627 VSTEEYLCMKVLLLLNTVPKDGLKSQSVFDELRMSYI------------------KELGKAIVKR 673

  Fly   386 NDARSALHNYIQRTHPSQPMRFQTLLGVVQLMHKVSSFTIEELFF 430
            .:..|  .|:         .||..|..::..||.:....:...|:
Zfish   674 EENSS--QNW---------QRFYQLTKLLDSMHDLVGGLLNFCFY 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 36/94 (38%)
NR_LBD 215..436 CDD:416257 42/224 (19%)
nr3c1NP_001018547.2 GCR 18..369 CDD:280340 2/11 (18%)
NR_DBD_GR_PR 383..460 CDD:143546 33/78 (42%)
NR_LBD_GR_Like 500..744 CDD:132745 46/259 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.