DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nr6a1b

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001028892.1 Gene:nr6a1b / 497167 ZFINID:ZDB-GENE-040724-202 Length:455 Species:Danio rerio


Alignment Length:443 Identity:108/443 - (24%)
Similarity:185/443 - (41%) Gaps:103/443 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.:|.|.:||.||||.:|:||.|||||||...|.|.|...|.  |.:.:..||:|:.|||:||.:
Zfish    41 CLICGDRASGLHYGIISCEGCKGFFKRSICNKRIYRCNRDKN--CQMSRKQRNRCQYCRLQKCLQ 103

  Fly    99 VGMNKDAVQHE--RGPRNSTLRR-HMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPG 160
            :|||:.|::.:  .|.||..:.. |:::.:...:.:|:..:..::  ::.:...|:.....|...
Zfish   104 MGMNRKAIREDGMPGGRNKMIGPVHISLEEIERLMSGQEFKEGSD--LSDSWSHGYSNHSSPGNS 166

  Fly   161 LPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPH------HPVHQGHHGFFSPTAAYMNA----- 214
            |.:     .....:|....|.:...:...|::.|      :|:.       .||.:.:..     
Zfish   167 LSE-----GGQSLSFSSSRSVSCRDECISPQLTHTFLMCKYPLP-------PPTGSILKTQTHTL 219

  Fly   215 ----LATRALPP-TPPLMAAEHIKET-----------AAEHLFKNVNWIKSVRAFTELPMPDQLL 263
                ||...|.| |.|::..:....|           |.|.||:.:.|:|.:..||:|.:.|...
Zfish   220 TGQILADEDLTPLTTPMLIEDGYSVTQSELLALLCGIADELLFRQIVWLKRLPFFTDLSIKDCTR 284

  Fly   264 LLEESWKEFFILAMAQYLMPMNFAQLLFVYESENANREIMGMVTREVHAFQ-------EVLNQL- 320
            ||..||.:..:|:.    :.::.||:|    .|.||  :....|...|..|       ||:..| 
Zfish   285 LLGSSWHQLILLSS----ITVHSAQIL----GELAN--VTHHYTPSSHTLQRFGEDAMEVMESLN 339

  Fly   321 ------CHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESG 379
                  ..|||.:.||.||:.|:|..:                             |:.||..:.
Zfish   340 FLFRKFHQLNISNEEYSCLKTITLLNQ-----------------------------ETTGLCNTS 375

  Fly   380 KVAAMHNDARSALHNYIQRTHPSQPMRFQTLLG-VVQLMH---KVSSFTIEEL 428
            .:..:.....:......:|.||.:|.||..::. :.::.|   |:.|..:|:|
Zfish   376 MLKQLSERYWTLCRELTERLHPQRPKRFSDIITCLTEIRHTSGKMMSIPLEQL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 39/84 (46%)
NR_LBD 215..436 CDD:416257 57/244 (23%)
nr6a1bNP_001028892.1 NR_DBD_GCNF_like 33..122 CDD:143543 38/82 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..173 3/34 (9%)
NR_LBD_DHR4_like 222..434 CDD:132751 57/246 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.