DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and NR4A2

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_005246678.1 Gene:NR4A2 / 4929 HGNCID:7981 Length:609 Species:Homo sapiens


Alignment Length:424 Identity:94/424 - (22%)
Similarity:164/424 - (38%) Gaps:134/424 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.||.|:::.:|||:..|:||.|||||:::::.:|||.:.|.  |.|||..||:|:.||.:||..
Human   274 CAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKN--CPVDKRRRNRCQYCRFQKCLA 336

  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMG-AGEMPQIPAEILMNTAALTGFPGVPMPMPGLP 162
            |||.|:.|:                 .|::.| .|.:|..|..           |..|.|     
Human   337 VGMVKEVVR-----------------TDSLKGRRGRLPSKPKS-----------PQEPSP----- 368

  Fly   163 QRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLM 227
                          |.|..:.:..|....|..:|.              |.:|........|...
Human   369 --------------PSPPVSLISALVRAHVDSNPA--------------MTSLDYSRFQANPDYQ 405

  Fly   228 AA----EHIKE-----TAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMP 283
            .:    :||::     |.:..:.:  .|.:.:..|.:||..||.||.|.::.|.|:|.:|....|
Human   406 MSGDDTQHIQQFYDLLTGSMEIIR--GWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNP 468

  Fly   284 MNFAQLLFVYESENANREIMGMVTREVHAFQ-------------EVLNQLCHLNIDSTEYECLRA 335
            :. .:|:|          ..|:|   :|..|             |..:.|.::|||.:.:.|:.|
Human   469 VE-GKLIF----------CNGVV---LHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAA 519

  Fly   336 ISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTH 400
            :::.                              .|..||.|..:|..:.|...:.|.:::...:
Human   520 LAMV------------------------------TERHGLKEPKRVEELQNKIVNCLKDHVTFNN 554

  Fly   401 P--SQPMRFQTLLGVVQLMHKVSSFTIEELFFRK 432
            .  ::|.....|||.:..:..:.:..::.:|:.|
Human   555 GGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLK 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 35/82 (43%)
NR_LBD 215..436 CDD:416257 45/242 (19%)
NR4A2XP_005246678.1 NR_DBD_NGFI-B 272..346 CDD:143527 35/90 (39%)
NR_LBD_Nurr1 372..609 CDD:132756 49/277 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.