DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and ubxn6

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001005818.1 Gene:ubxn6 / 448295 XenbaseID:XB-GENE-971811 Length:427 Species:Xenopus tropicalis


Alignment Length:313 Identity:61/313 - (19%)
Similarity:105/313 - (33%) Gaps:83/313 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GHHPAHMAAFQPPPSAAAVLDLSV-PRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMAA 229
            |..|.|..:.....:.|.|....| ||.|             ||.....|.|:.|:.....|...
 Frog    16 GAGPGHKLSEDTRENVAKVTKEQVKPRKP-------------PTGEAQIAAASAAMARMESLQGR 67

  Fly   230 EHI---------KETAAEHLFKNV-------NWIKSVRAFTEL---PMPDQLLLLEESWKEFFIL 275
            ..:         ||...:....||       ...||....|.|   |:.|:||..||  :|..|.
 Frog    68 TKVQSKDTTTGRKEMIEQKEESNVGPKDIGTTRKKSSSVCTVLFRCPLTDELLRKEE--REGHIR 130

  Fly   276 AMAQYLMPMN--FAQLLFVYESENANREIMGMVTREVHAFQEVL------NQLCHLNIDSTEYE- 331
            .:.|.|...:  .|.:|.:: :.|.:||.:.:.|..:..:...:      .:.|.:.:.:..:: 
 Frog   131 NVLQRLSTTDPTSAAILKIH-TYNKDREKVKLGTETIAKYMNNIISHPEEEKYCRIKLSNKVFQE 194

  Fly   332 ---CL-------RAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHN 386
               ||       .|:...:|:.|.    :||.....:.|..                    |:.|
 Frog   195 KISCLEGSHEFFEAVGFEKKTMPG----QDLQEEFFVLGGD--------------------ALKN 235

  Fly   387 DARSALHNYIQRTHPSQPMR--FQTLLGVVQLMHKVSSFTIEELFFRKTIGDI 437
              ..|||.:......::|:|  .:..|.:.....:.:.|.:.:.||..|..:|
 Frog   236 --LDALHGHCDALLSAEPLRLSLERQLRIFMPSIEAAHFDLPDDFFNLTAEEI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537
NR_LBD 215..436 CDD:416257 48/260 (18%)
ubxn6NP_001005818.1 PUB_UBXD1 146..249 CDD:198418 19/129 (15%)
TGS 318..395 CDD:330245
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.