DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Hnf4

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster


Alignment Length:429 Identity:110/429 - (25%)
Similarity:172/429 - (40%) Gaps:120/429 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.:|.|.::|||||..:||||.|||:||:|::.||.|:..:.  |||||..|||||.|||||||:
  Fly   170 CAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARN--CVVDKDKRNQCRYCRLRKCFK 232

  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQ 163
            .||.|:|||:||.  ..:.||......|...|...:..:.||   |.:.              ..
  Fly   233 AGMKKEAVQNERD--RISCRRTSNDDPDPGNGLSVISLVKAE---NESR--------------QS 278

  Fly   164 RAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMA 228
            :||      ||.:|..:.    |||                                  .....:
  Fly   279 KAG------AAMEPNINE----DLS----------------------------------NKQFAS 299

  Fly   229 AEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVY 293
            ...:.|:..:.|...|.|.|.:.||.||.:.||:.||.....|..:|.:::..|.:....||   
  Fly   300 INDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHLKDVLLL--- 361

  Fly   294 ESENANREIMGMVTRE----------------VHAFQEVLNQLCHLNIDSTEYECLRAISLFRKS 342
             |.|.      ::||.                .....|::..:..:.||.||:.|::|:..|   
  Fly   362 -SNNC------VITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFF--- 416

  Fly   343 PPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRF 407
                                .||      ::||.|..::.::.:...:.|.:||.........||
  Fly   417 --------------------DPN------AKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRF 455

  Fly   408 QTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
            ..:|.::.::..::...||::.|.|..|...|..|:.:|
  Fly   456 GEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEM 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 46/82 (56%)
NR_LBD 215..436 CDD:416257 45/236 (19%)
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 45/76 (59%)
NR_LBD_HNF4_like 264..494 CDD:132729 59/329 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D34630at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.