DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Hr96

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_524493.1 Gene:Hr96 / 42993 FlyBaseID:FBgn0015240 Length:723 Species:Drosophila melanogaster


Alignment Length:446 Identity:82/446 - (18%)
Similarity:135/446 - (30%) Gaps:175/446 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.||.|.:.|.::....|:.|..||:|:....:|:.|...:.  |.:....|..|:.||||||.:
  Fly     7 CAVCGDKALGYNFNAVTCESCKAFFRRNALAKKQFTCPFNQN--CDITVVTRRFCQKCRLRKCLD 69

  Fly    99 VGMNKDAVQHERG--------PRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVP 155
            :||..:.:..|..        ..|...||.|....||....|                       
  Fly    70 IGMKSENIMSEEDKLIKRRKIETNRAKRRLMENGTDACDADG----------------------- 111

  Fly   156 MPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRAL 220
                      |....|.|   |..|:::.||       |:...|......|..:........:|.
  Fly   112 ----------GEERDHKA---PADSSSSNLD-------HYSGSQDSQSCGSADSGANGCSGRQAS 156

  Fly   221 PP----TPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYL 281
            .|    .|..|.||.|.:.....                   ||:                    
  Fly   157 SPGTQVNPLQMTAEKIVDQIVSD-------------------PDR-------------------- 182

  Fly   282 MPMNFAQLLFVYESENANR------EIMGMVTREVHAFQEVLNQLCHLNIDSTEY--ECLRAISL 338
                        .|:..||      |.:.::.:.:.:.::.|..:.||    .:|  :.|:.||.
  Fly   183 ------------ASQAINRLMRTQKEAISVMEKVISSQKDALRLVSHL----IDYPGDALKIISK 231

  Fly   339 FRKSPPSA---------SSTE------------------------------DLAN---------- 354
            |..||.:|         |.|:                              |:.|          
  Fly   232 FMNSPFNALTVFTKFMSSPTDGVEIISKIVDSPADVVEFMQNLMHSPEDAIDIMNKFMNTPAEAL 296

  Fly   355 ---SSILTGSGSPNSSASAESRGLLE---SGKVAAMHNDARSALHNYIQRTHPSQP 404
               :.||:|.|:..:..:|:.:.||:   :.|.||....|.:.:.:.:..:.|..|
  Fly   297 RILNRILSGGGANAAQQTADRKPLLDKEPAVKPAAPAERADTVIQSMLGNSPPISP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 25/90 (28%)
NR_LBD 215..436 CDD:416257 41/257 (16%)
Hr96NP_524493.1 NR_DBD_CAR 5..98 CDD:143524 25/92 (27%)
NR_LBD 462..>573 CDD:299703
NR_LBD_F1 523..702 CDD:132727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.