DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Hr83

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster


Alignment Length:407 Identity:110/407 - (27%)
Similarity:149/407 - (36%) Gaps:142/407 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.||.|.|||||||:..||||:.|||||:||...|.|.: ..|.|||||..||.|.:||.::|..
  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIA-LVGNCVVDKARRNWCPSCRFQRCLA 70

  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQ 163
            ||||..|||.||||||    :.:|:|                                       
  Fly    71 VGMNAAAVQEERGPRN----QQVALY--------------------------------------- 92

  Fly   164 RAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMA 228
            |.|..       |.|||.||.                     |||                |...
  Fly    93 RTGRR-------QAPPSQAAP---------------------SPT----------------PHSQ 113

  Fly   229 AEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVY 293
            |.|. :..|:.|...:...|:...|..|....|..:.:..|.|.|:|..:.:.:.:: |.:    
  Fly   114 ALHF-QILAQILVTCLRQAKANEQFALLDRCQQDAIFQVVWSEIFVLRASHWSLDIS-AMI---- 172

  Fly   294 ESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSIL 358
              :....|.:..:..|.|          .|..|..|...:.::.|.||         :||     
  Fly   173 --DGCGDEQLKRLICEAH----------QLRADVLELNFMESLILCRK---------ELA----- 211

  Fly   359 TGSGSPNSSASAESRGLLESGKVAAMHNDARSALH--NYIQRTHPSQPMRF-QTLLGVVQLMHKV 420
                     .:||...:|.|...||:.:.||..|.  ||         :|| |.|||:.||..:.
  Fly   212 ---------INAEYAVILGSHSKAALISLARYTLQQSNY---------LRFGQLLLGLRQLCLRR 258

  Fly   421 SSFTIEELFFRKTIGDI 437
            ....: ...||..:.||
  Fly   259 FDCAL-SCMFRSVVRDI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 49/82 (60%)
NR_LBD 215..436 CDD:416257 46/223 (21%)
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 49/85 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.