DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and eg

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_524206.1 Gene:eg / 40428 FlyBaseID:FBgn0000560 Length:373 Species:Drosophila melanogaster


Alignment Length:185 Identity:50/185 - (27%)
Similarity:81/185 - (43%) Gaps:28/185 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYV-CKSQKQGLCVVDKTHRNQCRACRLRKCF 97
            ||||.:.::|.|:|.:.|:||..||.|:........ ||  ..|.||::|.:|..|:|||||||.
  Fly     5 CKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAGCK--HNGDCVINKKNRTACKACRLRKCL 67

  Fly    98 EVGMNKDAVQHERGPRNSTLRRHMAMYKD---------AMMGAGEMPQIPAEILMNTAALTGFPG 153
            .|||:|...::  |.|::..:.|..:.:.         :.:|:|....:.:..|...|.|     
  Fly    68 LVGMSKSGSRY--GRRSNWFKIHCLLQEQQTTSGLGGGSSVGSGSGGGVSSASLEQLARL----- 125

  Fly   154 VPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPT 208
                     |:|.:........:..|...:....:.||:....|..|..|..||:
  Fly   126 ---------QQASNQARQTYQDKTNPCIKSATATTSPRIEGAAVGTGIGGGASPS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 34/83 (41%)
NR_LBD 215..436 CDD:416257
egNP_524206.1 NR_DBD_like 3..87 CDD:295381 34/85 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.