DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Eip78C

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001246862.1 Gene:Eip78C / 40345 FlyBaseID:FBgn0004865 Length:862 Species:Drosophila melanogaster


Alignment Length:537 Identity:118/537 - (21%)
Similarity:178/537 - (33%) Gaps:186/537 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QSSEGSPDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSR 66
            |.|.|..|......:|...:..:|...   ||||||.|.:||.|||:.:|:||.|||:|||::..
  Fly   334 QQSFGLADSSSSNGSSNNNNGVSSKSF---VPCKVCGDKASGYHYGVTSCEGCKGFFRRSIQKQI 395

  Fly    67 QYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHM--AMYKDAMM 129
            :|.|  .:.|.|:|.:.:||:|:.||.:||...||::|:|::.|.|:.|   |.:  |....|..
  Fly   396 EYRC--LRDGKCLVIRLNRNRCQYCRFKKCLSAGMSRDSVRYGRVPKRS---RELNGAAASSAAA 455

  Fly   130 GAGEMPQIPAEI-LMNTAALTGFPG-----VPMPMPGLPQRAGHHPA----HMAAFQPPPSAAAV 184
            ||      ||.: :.::.:.|..|.     ....:....|:..|.|.    |....||..|...|
  Fly   456 GA------PASLNVDDSTSSTLHPSHLQQQQQQHLLQQQQQQQHQPQLQQHHQLQQQPHVSGVRV 514

  Fly   185 LDLSVPRVPH------------------------------------------------------- 194
            ...|.|:.|.                                                       
  Fly   515 KTPSTPQTPQMCSIASSPSELGGCNSANNNNNNNNNSSSGNASGGSGVSVGVVVVGGHQQLVGGS 579

  Fly   195 -----------HPVHQGHHGFFSPTA--------------------AYMNALATRALPPTPPLMA 228
                       |.|...|.| .:.||                    :|...| ||.|...|..:.
  Fly   580 MVGMAGMGTDAHQVGMCHDG-LAGTANELTVYDVIMCVSQAHRLNCSYTEEL-TRELMRRPVTVP 642

  Fly   229 AEHIKETAAEHL-FKNVNWI-------------------KSVRAFTELPMPDQLLLLEESWKEFF 273
            ...|..|.||.| |:.: |:                   |.|..|.:....|||:|::..:.|.:
  Fly   643 QNGIASTVAESLEFQKI-WLWQQFSARVTPGVQRIVEFAKRVPGFCDFTQDDQLILIKLGFFEVW 706

  Fly   274 ILAMAQYLMPMNFA----------QLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDST 328
            :..:|:.:......          ||..:|:|:..|            |.....|.|....:..|
  Fly   707 LTHVARLINEATLTLDDGAYLTRQQLEILYDSDFVN------------ALLNFANTLNAYGLSDT 759

  Fly   329 EYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALH 393
            |      |.||              ::.:|..|         :..||.|...:.........||.
  Fly   760 E------IGLF--------------SAMVLLAS---------DRAGLSEPKVIGRARELVAEALR 795

  Fly   394 NYIQRTHPSQPMRFQTL 410
            ..|.|:....|...|.:
  Fly   796 VQILRSRAGSPQALQLM 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 41/91 (45%)
NR_LBD 215..436 CDD:416257 45/226 (20%)
Eip78CNP_001246862.1 NR_DBD_DmE78_like 363..443 CDD:143539 38/84 (45%)
NR_LBD_DmE78_like 659..854 CDD:132739 34/196 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.