DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and knrl

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001303368.1 Gene:knrl / 40285 FlyBaseID:FBgn0001323 Length:647 Species:Drosophila melanogaster


Alignment Length:219 Identity:60/219 - (27%)
Similarity:94/219 - (42%) Gaps:61/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRR-SRQYVCKSQ 73
            ||:|.      :|.|.::     .||||.:.::|.|:|.:.|:||..||.||... |....||: 
  Fly     1 MMNQD------NPYAMNQ-----TCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSISDCKN- 53

  Fly    74 KQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRH-------------MAMYK 125
             .|.|:::|.:|..|:||||:||..|||:|...::  |.|::..:.|             ||.:.
  Fly    54 -NGECIINKKNRTACKACRLKKCLMVGMSKSGSRY--GRRSNWFKIHCLLQEQQQQAVAAMAAHH 115

  Fly   126 DAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVP 190
            ::....|.          ::....|..|:|..:.|           |:...||.:|||.|.:   
  Fly   116 NSQQAGGG----------SSGGSGGGQGMPNGVKG-----------MSGVPPPAAAAAALGM--- 156

  Fly   191 RVPHHPVHQGHHGFFSPTAAYMNA 214
                    .||.|.:....|..||
  Fly   157 --------LGHPGGYPGLYAVANA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 34/92 (37%)
NR_LBD 215..436 CDD:416257 60/219 (27%)
knrlNP_001303368.1 NR_DBD_like 12..96 CDD:295381 34/92 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.