DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and esr2

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001035101.1 Gene:esr2 / 394460 XenbaseID:XB-GENE-486256 Length:548 Species:Xenopus tropicalis


Alignment Length:381 Identity:100/381 - (26%)
Similarity:147/381 - (38%) Gaps:74/381 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVV 80
            |:|..:|.:.....:   |.||.|::||.|||:::|:||..||||||:....|:|.:..|  |.:
 Frog   152 NNVGSNPGSKRDTHF---CAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQ--CTI 211

  Fly    81 DKTHRNQCRACRLRKCFEVGMNKDAVQHER-GPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMN 144
            ||..|..|:||||||||||||.|...:.|| |.|....|||.   .|.|....:..::...|   
 Frog   212 DKNRRKSCQACRLRKCFEVGMMKCGTRRERCGYRIVRHRRHS---DDQMHCLAKNKKLTDNI--- 270

  Fly   145 TAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTA 209
                              ||.....|  ::..|......:.|...|.|                 
 Frog   271 ------------------QRVKEISA--SSLGPEQFVLIISDAEPPNV----------------- 298

  Fly   210 AYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFI 274
                .|..|...|.........:.:.|.:.|...:.|.|.:..|.||.:.||:.|||..|.|  |
 Frog   299 ----MLMNRLCKPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLYDQVRLLESCWLE--I 357

  Fly   275 LAMAQYLMPMNFAQLLFVYESENANREIMGMVTREVHAFQEVL---NQLCHLNIDSTEYECLRAI 336
            |.|......::....|........:|:....|...:..|..:|   ::|..|.:...|:.||:.:
 Frog   358 LMMGLMWRSIDHPGKLLFAPDLTLDRDEGKCVEGILEIFDMLLATTSRLRELKLQHREFLCLKVM 422

  Fly   337 SLFRKSPPSASSTEDLANSS----------------ILTGSGSPNSSASAESRGLL 376
            .|........:|:|:.:.||                ::..||.|....|.....||
 Frog   423 ILLNSHVFPLTSSEEESESSRKLHHPLNTVTDALVWVIAKSGIPFRQQSTRLANLL 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 43/92 (47%)
NR_LBD 215..436 CDD:416257 41/181 (23%)
esr2NP_001035101.1 ERbeta_N 39..139 CDD:289279
NR_DBD_ER 162..243 CDD:143545 41/85 (48%)
NR_LBD_ER 281..517 CDD:132747 45/221 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.