DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nr2f1b

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_956886.1 Gene:nr2f1b / 393564 ZFINID:ZDB-GENE-040426-1438 Length:389 Species:Danio rerio


Alignment Length:473 Identity:138/473 - (29%)
Similarity:201/473 - (42%) Gaps:147/473 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QSSEG--------SPDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFF 58
            ||:.|        ||...::|     ...||.::  .||.|.||.|.|||||||.:.|:||..||
Zfish    21 QSAAGREHLQHRHSPKSAEEK-----AQIAAQNQ--QHVECVVCGDKSSGKHYGQFTCEGCKSFF 78

  Fly    59 KRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAM 123
            |||:||:..|.|::.:.  |.||:.|||||:.|||:||.:|||.::|||..|.|.|         
Zfish    79 KRSVRRNLSYTCRANRN--CPVDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPN--------- 132

  Fly   124 YKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLS 188
                                                                ||.||        
Zfish   133 ----------------------------------------------------QPNPS-------- 137

  Fly   189 VPRVPHHPVHQGHH--------GFFS--------PTAAYMNALATRALPPTPPLMAAEHIKETAA 237
                 |:.:..|.|        |:.|        |.:.|.|...     .:..:|..|:|.|.||
Zfish   138 -----HYALTNGDHLNGQCYLSGYISLLLRAEPYPASRYGNQCM-----QSGNIMGIENICELAA 192

  Fly   238 EHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLF---VYESE-NA 298
            ..||..|.|.:::..|.:|.:.||:.||..:|.|.|:|..||..||::.|.||.   ::.|. :|
Zfish   193 RLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQSSMPLHVAPLLAAAGLHASPMSA 257

  Fly   299 NREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGS 363
            :|.:..|  ..:..|||.:.:|..|.:||.||.|.:||.||                        
Zfish   258 DRVVAFM--DHIRFFQEQVEKLKALQVDSAEYSCAKAIVLF------------------------ 296

  Fly   364 PNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTLLGVVQLMHKVSSFTIEEL 428
                 ::::.||.:...:..:...::.||..|::..:|:||.||..||..:..:..|||..||:|
Zfish   297 -----TSDACGLSDIPHIEGLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPALRMVSSSVIEQL 356

  Fly   429 FFRKTIGDITIVRLISDM 446
            ||.:.:|...|..||.||
Zfish   357 FFVRLVGKTPIETLIRDM 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 47/91 (52%)
NR_LBD 215..436 CDD:416257 65/224 (29%)
nr2f1bNP_956886.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..39 5/17 (29%)
NR_DBD_COUP_TF 54..126 CDD:143516 41/73 (56%)
NR_LBD_COUP-TF 152..387 CDD:132746 76/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.