DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Hr3

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001334718.1 Gene:Hr3 / 36073 FlyBaseID:FBgn0000448 Length:871 Species:Drosophila melanogaster


Alignment Length:509 Identity:111/509 - (21%)
Similarity:179/509 - (35%) Gaps:172/509 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKC 96
            :|||||.|.|||.|||:..|:||.|||:||......|.|...||  ||||:.:||:|:.|||:||
  Fly   435 IPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSVVNYQCPRNKQ--CVVDRVNRNRCQYCRLQKC 497

  Fly    97 FEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGL 161
            .::||::|||:..|                  |...:..::..|:..                  
  Fly   498 LKLGMSRDAVKFGR------------------MSKKQREKVEDEVRF------------------ 526

  Fly   162 PQRAGHHPAHMAAFQPPPSAAAVLDLSVP----RVPHHPVHQGHH-----GFFSP---------- 207
                  |.|.|.|.......::|.|...|    ::.|:..:.|.:     |:.||          
  Fly   527 ------HRAQMRAQSDAAPDSSVYDTQTPSSSDQLHHNNYNSGGYSNNEVGYGSPYGYSASVTPQ 585

  Fly   208 -------TAAYMNALATRALPPTPPLMAAEH------------IKETAAEH-------------- 239
                   :|.|::   :....|...::..|.            ||..|..|              
  Fly   586 QTMQYDISADYVD---STTYEPRSTIIDPEFISHADGDINDVLIKTLAEAHANTNTKLEAVHDMF 647

  Fly   240 ----------LFKNVN----WI-----------------KSVRAFTELPMPDQLLLLEESWKEFF 273
                      .:||:.    |:                 |.:..|..|...||:|||:....|..
  Fly   648 RKQPDVSRILYYKNLGQEELWLDCAEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSFELA 712

  Fly   274 ILAMAQYLMPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISL 338
            |:.|::.|   :.:|          |..:.|.|         :|.|......||.|...:..|..
  Fly   713 IVRMSRLL---DLSQ----------NAVLYGDV---------MLPQEAFYTSDSEEMRLVSRIFQ 755

  Fly   339 FRKSPPSASSTED---LANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTH 400
            ..||......||.   |..|.:|..         .|..|:..:.::..:.|.:.:|:...::..|
  Fly   756 TAKSIAELKLTETELALYQSLVLLW---------PERNGVRGNTEIQRLFNLSMNAIRQELETNH 811

  Fly   401 PSQPMR-----FQTLLGVVQLMHKVSSFTIEELF-FRKTIGDITIVRLISDMYS 448
              .|::     ..|||..:.....:|...:|.|. |:....::....|..:::|
  Fly   812 --APLKGDVTVLDTLLNNIPNFRDISILHMESLSKFKLQHPNVVFPALYKELFS 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 42/84 (50%)
NR_LBD 215..436 CDD:416257 51/286 (18%)
Hr3NP_001334718.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.