DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and ZK418.11

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001022997.1 Gene:ZK418.11 / 3565390 WormBaseID:WBGene00044354 Length:301 Species:Caenorhabditis elegans


Alignment Length:220 Identity:40/220 - (18%)
Similarity:81/220 - (36%) Gaps:79/220 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 LFKNVNWIKSVRAFTELPMPDQL------------LLLEESWKEFFILAMA--QYLMPMNFAQLL 290
            :|.:.:|: ::.|||.|....::            |:|:.|:....|:.||  .|.....|  ::
 Worm   106 VFTSHDWV-AIEAFTTLEFMKRIHFVKMLNADEANLILKHSFFTLSIVFMAGRSYFDKKEF--MV 167

  Fly   291 F-----VYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTE 350
            |     |:..|.:::..:.::.| :..  .::::...|.|.:.|: .|..|:.|.:.        
 Worm   168 FPGKVDVFPEEISDQYPLDLLNR-IRC--RLISKFIELRITTEEF-LLMVITYFCQI-------- 220

  Fly   351 DLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQ------------RTHPSQ 403
                ||:|.||                         .|:..:..|:.            |.....
 Worm   221 ----SSMLVGS-------------------------SAKRIIEEYLSIYLSTLGINCNFRFQKHG 256

  Fly   404 PMRFQTLLGVVQLMHKVSSFTIEEL 428
            .:|:..::.:.||:.|    |||:|
 Worm   257 RIRYLNIIFLSQLIEK----TIEDL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537
NR_LBD 215..436 CDD:416257 40/220 (18%)
ZK418.11NP_001022997.1 HOLI 118..273 CDD:214658 33/201 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.