Sequence 1: | NP_524596.1 | Gene: | tll / 43656 | FlyBaseID: | FBgn0003720 | Length: | 452 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001022996.1 | Gene: | ZK418.10 / 3565356 | WormBaseID: | WBGene00044353 | Length: | 293 | Species: | Caenorhabditis elegans |
Alignment Length: | 233 | Identity: | 42/233 - (18%) |
---|---|---|---|
Similarity: | 79/233 - (33%) | Gaps: | 74/233 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 233 KETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVYESEN 297
Fly 298 ------------------------------ANREIMGMVTREV---HAFQEVLNQLCH--LNIDS 327
Fly 328 TEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSAL 392
Fly 393 HNYIQRTH-PSQPMRFQTLLGVVQLM----HKVSSFTI 425 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tll | NP_524596.1 | NR_DBD_TLX | 25..117 | CDD:143537 | |
NR_LBD | 215..436 | CDD:416257 | 42/233 (18%) | ||
ZK418.10 | NP_001022996.1 | HOLI | 105..266 | CDD:214658 | 30/185 (16%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |