DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and ZK418.10

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001022996.1 Gene:ZK418.10 / 3565356 WormBaseID:WBGene00044353 Length:293 Species:Caenorhabditis elegans


Alignment Length:233 Identity:42/233 - (18%)
Similarity:79/233 - (33%) Gaps:74/233 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 KETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVYESEN 297
            |.:....:...:|:||.         |..|:...|.|.....|:...::...:|......|..::
 Worm    77 KSSVDNAVISTINFIKK---------PPYLVFSMEEWTSINQLSTIDFIKKFDFVNQFSCYSDKS 132

  Fly   298 ------------------------------ANREIMGMVTREV---HAFQEVLNQLCH--LNIDS 327
                                          .|.:|....:.::   |...::.:||..  :.:|.
 Worm   133 KFIHGVRFKSAIFSTSMRVFNEKKSYMHFPGNVDIFPEHSSQLFNPHFLNKIRSQLIGKLIELDI 197

  Fly   328 TEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSAL 392
            |:.|.|...:||                  |..:..|:  .|.|.:.||.  |....::   :||
 Worm   198 TKNESLLLSALF------------------LCSAVHPD--ISTEGKNLLY--KYQQYYS---AAL 237

  Fly   393 HNYIQRTH-PSQPMRFQTLLGVVQLM----HKVSSFTI 425
            .|:...|: .:.|.|:..||.:.|::    .||::|.|
 Worm   238 INHCCLTNQQNAPSRYSELLSLYQIIEETHQKVNNFAI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537
NR_LBD 215..436 CDD:416257 42/233 (18%)
ZK418.10NP_001022996.1 HOLI 105..266 CDD:214658 30/185 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.