DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and AgaP_AGAP012921

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_561285.1 Gene:AgaP_AGAP012921 / 3292605 VectorBaseID:AGAP012921 Length:96 Species:Anopheles gambiae


Alignment Length:68 Identity:27/68 - (39%)
Similarity:42/68 - (61%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 MHNDARSALHNYIQRTHPSQPMRFQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDMYS 448
            :.:.|:..|..:::..:|.||.||..||.::.|:..:.|.|||.|||::|||.:.|.||:.|||.
Mosquito     2 LQDQAQCVLSEHVRVRYPRQPTRFGRLLLLLPLLRTIRSTTIETLFFKETIGTVPISRLLIDMYQ 66

  Fly   449 QRK 451
            ..|
Mosquito    67 MEK 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537
NR_LBD 215..436 CDD:416257 19/51 (37%)
AgaP_AGAP012921XP_561285.1 NR_LBD <1..53 CDD:299703 18/50 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BC6Q
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D34630at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.