DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Rorb

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001257887.1 Gene:Rorb / 309288 RGDID:1306778 Length:459 Species:Rattus norvegicus


Alignment Length:491 Identity:115/491 - (23%)
Similarity:205/491 - (41%) Gaps:123/491 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKC 96
            :|||:|.|.|||.|||:..|:||.|||:||.:.:..|.|..|:.  |::|:|:||:|:.|||:||
  Rat     8 IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRN--CLIDRTNRNRCQHCRLQKC 70

  Fly    97 FEVGMNKDAV------QHERGPRNSTLRRH-MAMYKDAMMGAGEMPQIPAEI--------LMNTA 146
            ..:||::|||      :.:|....:.:::| ..:.:.....:||...: |.:        |.|..
  Rat    71 LALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEAL-ARVYSSSISNGLSNLN 134

  Fly   147 ALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVH------------Q 199
            ..||.......:..||:..|::  ::.:.||.|..:.:....:.::...|::            .
  Rat   135 TETGGTYANGHVIDLPKSEGYY--NIDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSS 197

  Fly   200 GHHGFFSP--TAAYMNALATR-----------ALPPTPPLMAAEHIKETAAEHLFKN-------- 243
            .::|..:|  |.:.::.:|..           .:.....|....|..|....:..|:        
  Rat   198 FNNGQLAPGITMSEIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSKSREALWQQC 262

  Fly   244 -----------VNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVYESEN 297
                       |.:.|.:..|.||...||:|||:....|..::.|.:...|:|...|   :|.:.
  Rat   263 AIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVL---FEGKY 324

  Fly   298 ANREIMGMVTREVHAFQEVLNQ-------LCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANS 355
            .     ||...:.....:::|:       ||.|.:  ||.|    |:||              :|
  Rat   325 G-----GMQMFKALGSDDLVNEAFDFAKNLCSLQL--TEEE----IALF--------------SS 364

  Fly   356 SILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTLLGVVQLMHKV 420
            ::|         .|.:...|||..||..:......||.:.||:.|    :..:||   .:|:.|:
  Rat   365 AVL---------ISPDRAWLLEPRKVQKLQEKIYFALQHVIQKNH----LDDETL---AKLIAKI 413

  Fly   421 SSFTI------EEL-FFRKTIGDITIVRLISDMYSQ 449
            .:.|.      |:| .|:::..|| :..|...:|.:
  Rat   414 PTITAVCNLHGEKLQVFKQSHPDI-VNTLFPPLYKE 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 39/90 (43%)
NR_LBD 215..436 CDD:416257 54/264 (20%)
RorbNP_001257887.1 NR_DBD_ROR 3..97 CDD:143526 39/90 (43%)
NR_LBD_ROR_like 210..450 CDD:132737 58/284 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.