DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and rxrga

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_571292.3 Gene:rxrga / 30464 ZFINID:ZDB-GENE-980526-36 Length:441 Species:Danio rerio


Alignment Length:430 Identity:115/430 - (26%)
Similarity:184/430 - (42%) Gaps:108/430 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHR 85
            ||.:.|:   |: |.:|.|.|||||||:|:|:||.|||||:||:...|.|:..|.  |.:||..|
Zfish   108 SPGSLSK---HI-CAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYTCRDNKD--CQIDKRQR 166

  Fly    86 NQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTG 150
            |:|:.||.:||..:||.::|||.||    ...|.......|:.....|  ::|.|.:::      
Zfish   167 NRCQYCRYQKCLAMGMKREAVQEER----QRGRERSDNEVDSSSSFNE--EMPVEKILD------ 219

  Fly   151 FPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNAL 215
                               |.:|.   .|...|.::.|:....:.||                  
Zfish   220 -------------------AELAV---EPKTEAYMESSMSNSTNDPV------------------ 244

  Fly   216 ATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQY 280
                          .:|.:.|.:.||..|.|.|.:..|::||:.||::||...|.|..|.:.:..
Zfish   245 --------------TNICQAADKQLFTLVEWAKRIPHFSDLPLDDQVILLRAGWNELLIASFSHR 295

  Fly   281 LMPMN----FAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRK 341
            .:.:.    .|..|.|:.| :|:...:|.:...|  ..|:::::..:.:|.||..|||||.||  
Zfish   296 SVTVKDGILLATGLHVHRS-SAHSAGVGSIFDRV--LTELVSKMREMQMDKTELGCLRAIVLF-- 355

  Fly   342 SPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMR 406
                                       :.:::||....:|.|:.....::|..|.:..:|.||.|
Zfish   356 ---------------------------NPDAKGLSNPSEVEALREKVYASLEGYTKHNYPDQPGR 393

  Fly   407 FQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
            |..||..:..:..:....:|.|||.|.|||..|...:.:|
Zfish   394 FAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEM 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 43/91 (47%)
NR_LBD 215..436 CDD:416257 54/224 (24%)
rxrgaNP_571292.3 Modulating. /evidence=ECO:0000250 1..116 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..37
Nuc_recep-AF1 <40..111 CDD:288658 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..94
NR_DBD_RXR 115..191 CDD:143514 40/78 (51%)
Hinge 183..206 7/26 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..210 5/25 (20%)
NR_LBD_RXR_like 211..419 CDD:132741 61/299 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.