DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Esrrg

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_036065.1 Gene:Esrrg / 26381 MGIID:1347056 Length:458 Species:Mus musculus


Alignment Length:422 Identity:95/422 - (22%)
Similarity:168/422 - (39%) Gaps:105/422 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.||.|.:||.|||:.:|:.|..||||:|:.:.:|.|.:..:  |.:.|..|..|:|||..||.:
Mouse   128 CLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNE--CEITKRRRKSCQACRFMKCLK 190

  Fly    99 VGMNKDAVQHE--RGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGL 161
            |||.|:.|:.:  ||.|....||                 |.||            ..|...|.|
Mouse   191 VGMLKEGVRLDRVRGGRQKYKRR-----------------IDAE------------NSPYLNPQL 226

  Fly   162 PQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALP-PTPP 225
            .|.|                         :.|::.: ..|.....|...|       |:| ||.|
Mouse   227 VQPA-------------------------KKPYNKI-VSHLLVAEPEKIY-------AMPDPTVP 258

  Fly   226 ---LMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFA 287
               :.|...:.:.|...|...:.|.|.:..|:.|.:.||:.||:.:|.|..||.:.  ...::|.
Mouse   259 DSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVV--YRSLSFE 321

  Fly   288 -QLLFV--YESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASST 349
             :|::.  |..:....::.|::... :|..:::.:...:.::..|:..|:||:|           
Mouse   322 DELVYADDYIMDEDQSKLAGLLDLN-NAILQLVKKYKSMKLEKEEFVTLKAIAL----------- 374

  Fly   350 EDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTLLGVV 414
                              |:::|..:.:...|..:.:....||.:|....|...|.|...:|..:
Mouse   375 ------------------ANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTL 421

  Fly   415 QLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
            .|:.:.|:..::..:..|..|.:.:.:|..:|
Mouse   422 PLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEM 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 35/84 (42%)
NR_LBD 215..436 CDD:416257 43/227 (19%)
EsrrgNP_036065.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..85
NR_DBD_ERR 122..218 CDD:143544 40/120 (33%)
NR_LBD_ERR 237..456 CDD:132744 49/257 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.