DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Hnf4a

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_006235577.1 Gene:Hnf4a / 25735 RGDID:2810 Length:484 Species:Rattus norvegicus


Alignment Length:433 Identity:114/433 - (26%)
Similarity:173/433 - (39%) Gaps:139/433 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.:|.|.::|||||..:||||.|||:||:|::..|.|:..:|  |||||..|||||.|||:|||.
  Rat    60 CAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQ--CVVDKDKRNQCRYCRLKKCFR 122

  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQI----PAEILMN--TAALTGFPGVPMP 157
            .||.|:|||:|| .|.||.|   :.|:|:     .:|.|    .||:|..  |:.::|..|    
  Rat   123 AGMKKEAVQNER-DRISTRR---SSYEDS-----SLPSINALLQAEVLSQQITSPISGING---- 174

  Fly   158 MPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPP 222
                                        |:...|:.:                            
  Rat   175 ----------------------------DIRAKRIAN---------------------------- 183

  Fly   223 TPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQ-------- 279
                  ...:.|:..|.|...|.|.|.:.||.||.:.||:.||.....|..:|...:        
  Rat   184 ------ITDVCESMKEQLLVLVEWAKYIPAFCELLLDDQVALLRAHAGEHLLLGATKRSMVFKDV 242

  Fly   280 ------YLMPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISL 338
                  |::|.:..:|      ...:|..:.::...|..|||       |.||..||.||:||..
  Rat   243 LLLGNDYIVPRHCPEL------AEMSRVSIRILDELVLPFQE-------LQIDDNEYACLKAIIF 294

  Fly   339 FRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQ 403
            |                             ..:::||.:.||:..:.:..:.:|.:||.......
  Rat   295 F-----------------------------DPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDS 330

  Fly   404 PMRFQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
            ..||..||.::..:..::...||::.|.|..|...|..|:.:|
  Rat   331 RGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEM 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 47/82 (57%)
NR_LBD 215..436 CDD:416257 49/234 (21%)
Hnf4aXP_006235577.1 NR_DBD_HNF4A 60..135 CDD:143518 45/77 (58%)
NR_LBD_HNF4_like 151..373 CDD:132729 61/329 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.