DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Pgr

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_074038.2 Gene:Pgr / 25154 RGDID:3317 Length:926 Species:Rattus norvegicus


Alignment Length:458 Identity:106/458 - (23%)
Similarity:172/458 - (37%) Gaps:91/458 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DMMDQKY----NSVRLSPAASSRILY---HVP---CKVCRDHSSGKHYGIYACDGCAGFFKRSIR 63
            |.:.|.|    |.:|....||....|   .:|   |.:|.|.:||.|||:..|..|..||||::.
  Rat   525 DSLPQVYPPYLNYLRPDSEASQSPQYGFDSLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAME 589

  Fly    64 RSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAM 128
            ....|:|..:..  |:|||..|..|.|||||||.:.||....            |:.....|..:
  Rat   590 GQHNYLCAGRND--CIVDKIRRKNCPACRLRKCCQAGMVLGG------------RKFKKFNKVRV 640

  Fly   129 MGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVP 193
            |.|.:...:|..:           |:|.....|.||....|.......||     :::|.:...|
  Rat   641 MRALDGVALPQSV-----------GLPNESQTLGQRITFSPNQEIQLVPP-----LINLLMSIEP 689

  Fly   194 HHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPM 258
             ..|:.||......|:   ::|.|             .:.:.....|...|.|.||:..|..|.:
  Rat   690 -DVVYAGHDNTKPDTS---SSLLT-------------SLNQLGERQLLSVVKWSKSLPGFRNLHI 737

  Fly   259 PDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVYESENANREIMGMVTREVHAFQ------EVL 317
            .||:.|::.||....:..:..........|:|:.......|.:.|    :|:..:.      ::.
  Rat   738 DDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRM----KELSFYSLCLTMWQIP 798

  Fly   318 NQLCHLNIDSTEYECLRAISLFRKSP----PSASSTEDLANSSI--------LTGSG-SPNSSAS 369
            .:...|.:...|:.|::.:.|....|    .|.|..|::.:|.|        |...| .|:|...
  Rat   799 QEFVKLQVTHEEFLCMKVLLLLNTIPLEGLRSQSQFEEMRSSYIRELIKAIGLRQKGVVPSSQRF 863

  Fly   370 AESRGLLESGKVAAMHNDARSALHNYIQRT---HPSQPMRFQTLLG--VVQLMHKVSSFTIEELF 429
            .:...||:|     :| |....||.|...|   ..:..:.|..::.  :...:.|:.:..::.|.
  Rat   864 YQLTKLLDS-----LH-DLVKQLHLYCLNTFIQSRALAVEFPEMMSEVIAAQLPKILAGMVKPLL 922

  Fly   430 FRK 432
            |.|
  Rat   923 FHK 925

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 34/97 (35%)
NR_LBD 215..436 CDD:416257 47/242 (19%)
PgrNP_074038.2 Prog_receptor 1..557 CDD:396643 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
LXXL motif 1. /evidence=ECO:0000250|UniProtKB:P06401 56..60
LXXL motif 2. /evidence=ECO:0000250|UniProtKB:P06401 116..120
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..240
Mediates transcriptional transrepression (in isoform A). /evidence=ECO:0000250|UniProtKB:P06401 166..305
Nuclear localization signal. /evidence=ECO:0000255 185..189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..372
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..436
AF1, mediates transcriptional activation. /evidence=ECO:0000250|UniProtKB:P06401 453..539 4/13 (31%)
NR_DBD_GR_PR 556..633 CDD:143546 33/90 (37%)
NR_LBD_PR 679..926 CDD:132759 54/279 (19%)
AF2, mediates transcriptional activation. /evidence=ECO:0000250|UniProtKB:P06401 680..926 53/273 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.