DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Esr2

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_006240283.1 Gene:Esr2 / 25149 RGDID:2582 Length:567 Species:Rattus norvegicus


Alignment Length:443 Identity:109/443 - (24%)
Similarity:178/443 - (40%) Gaps:109/443 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.||.|::||.|||:::|:||..||||||:....|:|.:..|  |.:||..|..|:|||||||:|
  Rat   168 CAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQ--CTIDKNRRKSCQACRLRKCYE 230

  Fly    99 VGMNKDAVQHE-------RGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPM 156
            |||.|...:.|       |..|:|:.:.|  ....|....|..|:: .|:|::|           
  Rat   231 VGMVKCGSRRERCGYRIVRRQRSSSEQVH--CLSKAKRNGGHAPRV-KELLLST----------- 281

  Fly   157 PMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALP 221
                              ..|......:|:...|                      |.|.:|   
  Rat   282 ------------------LSPEQLVLTLLEAEPP----------------------NVLVSR--- 303

  Fly   222 PTPPLMAAE---HIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAM----AQ 279
            |:.|...|.   .:.:.|.:.|...:.|.|.:..|.||.:.||:.|||..|.|..::.:    ..
  Rat   304 PSMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLLDQVRLLESCWMEVLMVGLMWRSID 368

  Fly   280 YLMPMNFA-QLLFVYESENANREIMGMVT-------REVHAFQEVLNQLC-------HLNIDSTE 329
            :...:.|| .|:....||:.:..:..|.:       :.|....|:.:.|.       .|.:...|
  Rat   369 HPGKLIFAPDLVLDRSSEDPHWHVAQMKSAAPRDEGKCVEGILEIFDMLLATTSRFRELKLQHKE 433

  Fly   330 YECLRAISLFRKSP-PSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALH 393
            |.|::|:.|...|. |.||:.::..:|..||              .||.:...|.:...|:|.: 
  Rat   434 YLCVKAMILLNSSMYPLASANQEAESSRKLT--------------HLLNAVTDALVWVIAKSGI- 483

  Fly   394 NYIQRTHPSQPMRFQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
                 :...|.:|...||.::..:..:|:..:|.|...|....:.:..|:.:|
  Rat   484 -----SSQQQSVRLANLLMLLSHVRHISNKGMEHLLSMKCKNVVPVYDLLLEM 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 42/89 (47%)
NR_LBD 215..436 CDD:416257 54/243 (22%)
Esr2XP_006240283.1 ERbeta_N 35..141 CDD:289279
NR_DBD_ER 163..244 CDD:143545 39/77 (51%)
NR_LBD_ER 282..535 CDD:132747 60/295 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.