DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Esr1

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_017444286.2 Gene:Esr1 / 24890 RGDID:2581 Length:665 Species:Rattus norvegicus


Alignment Length:481 Identity:112/481 - (23%)
Similarity:182/481 - (37%) Gaps:146/481 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.||.|::||.|||:::|:||..||||||:....|:|.:..|  |.:||..|..|:|||||||:|
  Rat   223 CAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQ--CTIDKNRRKSCQACRLRKCYE 285

  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEM--------------PQIPAEILMNTAALT 149
            |||.|..::.:|  |...:.:|... :|.:.|..||              |.:......|:.||:
  Rat   286 VGMMKGGIRKDR--RGGRMLKHKRQ-RDDLEGRNEMGTSGDMRAANLWPSPLVIKHTKKNSPALS 347

  Fly   150 GFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRV-----PHHPVHQGHHGFFSPTA 209
                                  :.|.|   ..:|:||...|.:     |..|..:          
  Rat   348 ----------------------LTADQ---MVSALLDAEPPLIYSEYDPSRPFSE---------- 377

  Fly   210 AYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFI 274
            |.|..|.|                ..|...|...:||.|.|..|.:|.:.||:.|||.:|.|..:
  Rat   378 ASMMGLLT----------------NLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILM 426

  Fly   275 LAMAQ---------------------------YLMPMNFAQLLF------VYES-ENANREIMGM 305
            :.:..                           .|:.::|::..|      .:.| .|..:.:.||
  Rat   427 IGLVWRSMEHPGKLLFAPNLLLDRDIISGLQILLVSLDFSERTFNPLTKCPFSSLRNQGKCVEGM 491

  Fly   306 VTREVHAFQEVLNQLC-------HLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGS 363
            |        |:.:.|.       .:|:...|:.||::|.|.              ||.:.|...|
  Rat   492 V--------EIFDMLLATSSRFRMMNLQGEEFVCLKSIILL--------------NSGVYTFLSS 534

  Fly   364 PNSSASAES--RGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTLLGVVQLMHKVSSFTIE 426
            ...|...:.  ..:|:......:|..|::.|      |...|..|...||.::..:..:|:..:|
  Rat   535 TLKSLEEKDHIHRVLDKITDTLIHLMAKAGL------TLQQQHRRLAQLLLILSHIRHMSNKGME 593

  Fly   427 ELFFRKTIGDITIVRLISDMYSQRKI 452
            .|:..|....:.:..|:.:|....::
  Rat   594 HLYNMKCKNVVPLYDLLLEMLDAHRL 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 40/82 (49%)
NR_LBD 215..436 CDD:416257 51/263 (19%)
Esr1XP_017444286.2 Oest_recep 75..219 CDD:396642
NR_DBD_ER 218..299 CDD:143545 39/79 (49%)
NR_LBD_ER 348..617 CDD:132747 63/325 (19%)
ESR1_C 626..665 CDD:403830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.