DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Rara

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_017452499.1 Gene:Rara / 24705 RGDID:3534 Length:462 Species:Rattus norvegicus


Alignment Length:427 Identity:103/427 - (24%)
Similarity:165/427 - (38%) Gaps:119/427 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHR 85
            ||....||  :.||.||:|.|||.|||:.||:||.|||:|||:::..|.|...|.  |:::|..|
  Rat    77 SPPPLPRI--YKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKN--CIINKVTR 137

  Fly    86 NQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTG 150
            |:|:.|||:|||||||:|::|:::|..:..                 |.|:              
  Rat   138 NRCQYCRLQKCFEVGMSKESVRNDRNKKKK-----------------ETPK-------------- 171

  Fly   151 FPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNAL 215
                              |....::...|....:::         .|.:.|...| |....:...
  Rat   172 ------------------PECSESYTLTPEVGELIE---------KVRKAHQETF-PALCQLGKY 208

  Fly   216 ATRALPPTPPLMAAEH-----------IKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESW 269
            .|.        .::|.           ..|.:.:.:.|.|.:.|.:..||.|.:.||:.||:.:.
  Rat   209 TTN--------NSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAAC 265

  Fly   270 KEFFILAMAQYLMP----MNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEY 330
            .:..||.:.....|    |.|:..|.:..::..|.. .|.:|..|.||   .|||..|.:|..|.
  Rat   266 LDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAG-FGPLTDLVFAF---ANQLLPLEMDDAET 326

  Fly   331 ECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNY 395
            ..|.||.|.                             ..:.:.|.:..||..:......||..|
  Rat   327 GLLSAICLI-----------------------------CGDRQDLEQPDKVDMLQEPLLEALKVY 362

  Fly   396 IQRTHPSQPMRFQTLLGVVQLMHKVSSFTIEELFFRK 432
            :::..||:|..|..:|..:..:..:|:...|.:...|
  Rat   363 VRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 44/91 (48%)
NR_LBD 215..436 CDD:416257 49/233 (21%)
RaraXP_017452499.1 NR_DBD_RAR 82..166 CDD:143522 44/87 (51%)
NR_LBD_RAR 186..416 CDD:132735 53/265 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.