DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Nr2f6

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_620813.2 Gene:Nr2f6 / 245980 RGDID:621685 Length:390 Species:Rattus norvegicus


Alignment Length:436 Identity:135/436 - (30%)
Similarity:191/436 - (43%) Gaps:115/436 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRN 86
            |....|....|.|.||.|.|||||||::.|:||..||||||||:..|.|:|.:.  |.:|:.|||
  Rat    45 PGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRD--CQIDQHHRN 107

  Fly    87 QCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGF 151
            ||:.|||:|||.|||.|:|||..|                                         
  Rat   108 QCQYCRLKKCFRVGMRKEAVQRGR----------------------------------------- 131

  Fly   152 PGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALA 216
              :|..:||        ||..:    ||.||.|                 ..|..|..:.:.|..
  Rat   132 --IPHALPG--------PAACS----PPGAAGV-----------------EPFAGPPVSELIAQL 165

  Fly   217 TRALP-PTP-------PLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFF 273
            .||.| |..       .::..:::.|.||..||..|.|.:....|.|||..||:.||..||.|.|
  Rat   166 LRAEPYPAAGRFGGGGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPAADQVALLRLSWSELF 230

  Fly   274 ILAMAQYLMPMNFAQLLF---VYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRA 335
            :|..||..:|::.|.||.   ::.:..|....:..:. :|.||||.:::|..|.:|:.||.||:|
  Rat   231 VLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMD-QVRAFQEQVDKLGRLQVDAAEYGCLKA 294

  Fly   336 ISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTH 400
            |:||                             :.::.||.:...|.::...|:.||..|::..:
  Rat   295 IALF-----------------------------TPDACGLSDPAHVESLQEKAQVALTEYVRAQY 330

  Fly   401 PSQPMRFQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
            ||||.||..||..:..:..|.:..|.:|||.:.:|...|..||.||
  Rat   331 PSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDM 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 48/91 (53%)
NR_LBD 215..436 CDD:416257 67/231 (29%)
Nr2f6NP_620813.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 1/4 (25%)
NR_DBD_COUP_TF 57..129 CDD:143516 44/73 (60%)
NR_LBD_COUP-TF 157..387 CDD:132746 74/250 (30%)
Important for dimerization. /evidence=ECO:0000250 314..390 23/63 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.