DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and NR2F6

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_005225.2 Gene:NR2F6 / 2063 HGNCID:7977 Length:404 Species:Homo sapiens


Alignment Length:431 Identity:138/431 - (32%)
Similarity:197/431 - (45%) Gaps:91/431 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRN 86
            |....|....|.|.||.|.|||||||::.|:||..||||||||:..|.|:|.:.  |.:|:.|||
Human    44 PGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRD--CQIDQHHRN 106

  Fly    87 QCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTG- 150
            ||:.|||:|||.|||.|:|||..|.|.:         ...|:..:...|  |...|  .|..:| 
Human   107 QCQYCRLKKCFRVGMRKEAVQRGRIPHS---------LPGAVAASSGSP--PGSAL--AAVASGG 158

  Fly   151 --FPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMN 213
              |||.|:         ....|.:...:|.|:||                 |..|.....|.   
Human   159 DLFPGQPV---------SELIAQLLRAEPYPAAA-----------------GRFGAGGGAAG--- 194

  Fly   214 ALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMA 278
                       .::..:::.|.||..||..|.|.:....|.|||:.||:.||..||.|.|:|..|
Human   195 -----------AVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAA 248

  Fly   279 QYLMPMNFAQLLF---VYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFR 340
            |..:|::.|.||.   ::.:..|....:..:. :|.||||.:::|..|.:||.||.||:||:|| 
Human   249 QAALPLHTAPLLAAAGLHAAPMAAERAVAFMD-QVRAFQEQVDKLGRLQVDSAEYGCLKAIALF- 311

  Fly   341 KSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPM 405
                                        :.::.||.:...|.::...|:.||..|::..:||||.
Human   312 ----------------------------TPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQ 348

  Fly   406 RFQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
            ||..||..:..:..|.:..|.:|||.:.:|...|..||.||
Human   349 RFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDM 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 49/91 (54%)
NR_LBD 215..436 CDD:416257 64/223 (29%)
NR2F6NP_005225.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 1/4 (25%)
NR_DBD_COUP_TF 56..128 CDD:143516 44/73 (60%)
NR_LBD_COUP-TF 165..400 CDD:132746 79/295 (27%)
Important for dimerization. /evidence=ECO:0000250 327..404 23/63 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.