DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Nr1h4

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001157172.1 Gene:Nr1h4 / 20186 MGIID:1352464 Length:488 Species:Mus musculus


Alignment Length:406 Identity:94/406 - (23%)
Similarity:145/406 - (35%) Gaps:89/406 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKT 83
            |::.|::.||.....|.||.|.:||.||....|:||.|||:|||.::..|.||:  .|.||:|..
Mouse   123 RMAAASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKN--GGNCVMDMY 185

  Fly    84 HRNQCRACRLRKCFEVGMNKDAVQ----HERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMN 144
            .|.:|:.||||||.|:||..:.:.    .|...::..||:::..:.|......:.   ....|..
Mouse   186 MRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTANEDDS---EGRDLRQ 247

  Fly   145 TAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLD-----LSVPRVPHHPVHQGHHGF 204
            ..:.|.|              ......:.|.|     ..:||     .:..|:|....::.....
Mouse   248 VTSTTKF--------------CREKTELTADQ-----QTLLDYIMDSYNKQRMPQEITNKILKEE 293

  Fly   205 FSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESW 269
            ||   |..|.|.               :.|.|..|:...|.:.|.:..|..|...||:.||:.|.
Mouse   294 FS---AEENFLI---------------LTEMATSHVQILVEFTKKLPGFQTLDHEDQIALLKGSA 340

  Fly   270 KEFFILAMAQYL---MPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYE 331
            .|...|..|:..   :|...|.||   |.......|.......:.:|.:.:.:   |.:...||.
Mouse   341 VEAMFLRSAEIFNKKLPAGHADLL---EERIRKSGISDEYITPMFSFYKSVGE---LKMTQEEYA 399

  Fly   332 CLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYI 396
            .|.||.:.                             |.:.:.:.:...|..:.......|....
Mouse   400 LLTAIVIL-----------------------------SPDRQYIKDREAVEKLQEPLLDVLQKLC 435

  Fly   397 QRTHPSQPMRFQTLLG 412
            :...|..|..|..|||
Mouse   436 KMYQPENPQHFACLLG 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 38/95 (40%)
NR_LBD 215..436 CDD:416257 38/201 (19%)
Nr1h4NP_001157172.1 NR_DBD_FXR 135..222 CDD:143520 36/88 (41%)
NR_LBD_Fxr 264..483 CDD:132734 47/246 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.