DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and Rxrg

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_033133.1 Gene:Rxrg / 20183 MGIID:98216 Length:463 Species:Mus musculus


Alignment Length:456 Identity:117/456 - (25%)
Similarity:190/456 - (41%) Gaps:116/456 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQSSE------GSPDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFK 59
            :.|||      |.|.:.:..|.|.  ||.:   ::.|: |.:|.|.|||||||:|:|:||.||||
Mouse   106 VSSSEDIKPLPGLPGIGNMNYPST--SPGS---LVKHI-CAICGDRSSGKHYGVYSCEGCKGFFK 164

  Fly    60 RSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMY 124
            |:||:...|.|:..|.  |::||..||:|:.||.:||..:||.::|||.||      .|......
Mouse   165 RTIRKDLIYTCRDNKD--CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEER------QRSRERAE 221

  Fly   125 KDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSV 189
            .:|...:.....:|.|.::.                         |.:|.   .|...:..|::|
Mouse   222 SEAECASSSHEDMPVERILE-------------------------AELAV---EPKTESYGDMNV 258

  Fly   190 PRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFT 254
            ....:.||                                .:|...|.:.||..|.|.|.:..|:
Mouse   259 ENSTNDPV--------------------------------TNICHAADKQLFTLVEWAKRIPHFS 291

  Fly   255 ELPMPDQLLLLEESWKEFFILAMAQYLMPMN----FAQLLFVYESENANREIMGMVTREVHAFQE 315
            :|.:.||::||...|.|..|.:.:...:.:.    .|..|.|:.| :|:...:|.:...|  ..|
Mouse   292 DLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRS-SAHSAGVGSIFDRV--LTE 353

  Fly   316 VLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGK 380
            :::::..:.:|.:|..|||||.||                             :.:::||....:
Mouse   354 LVSKMKDMQMDKSELGCLRAIVLF-----------------------------NPDAKGLSNPSE 389

  Fly   381 VAAMHNDARSALHNYIQRTHPSQPMRFQTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISD 445
            |..:.....:.|..|.::.:|.||.||..||..:..:..:....:|.|||.|.|||..|...:.:
Mouse   390 VETLREKVYATLEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDSFLME 454

  Fly   446 M 446
            |
Mouse   455 M 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 42/91 (46%)
NR_LBD 215..436 CDD:416257 51/224 (23%)
RxrgNP_033133.1 Modulating. /evidence=ECO:0000250 1..138 9/36 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..53
Nuc_recep-AF1 25..133 CDD:288658 9/28 (32%)
NR_DBD_RXR 137..213 CDD:143514 40/78 (51%)
Hinge 205..230 7/30 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..232 4/26 (15%)
NR_LBD_RXR_like 233..441 CDD:132741 58/299 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.