DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-74

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_492919.2 Gene:nhr-74 / 191723 WormBaseID:WBGene00003664 Length:316 Species:Caenorhabditis elegans


Alignment Length:429 Identity:79/429 - (18%)
Similarity:142/429 - (33%) Gaps:150/429 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGK-HYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCF 97
            |:||:.....: ::||.:|..||.||:||  ...||:|.:...  |.:....:..|||||...|.
 Worm    11 CQVCQSTERTRLYFGITSCAACAAFFRRS--DGIQYMCTANNS--CTIAYDIKFFCRACRYESCV 71

  Fly    98 EVGMNKDAVQHERGPRNSTL-------RRHMAMYKDAMMGAGEMPQIP--------AEILMNTAA 147
            ..||.:|.|:..|..:|...       ..|:.:.....:|:....:..        ::||.||  
 Worm    72 RAGMRRDNVRKHRTHQNQAATPGAVIPELHLRLTPTDSLGSSSSSRSTSPDDSEEFSDILDNT-- 134

  Fly   148 LTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYM 212
                                  .|:         :::.||.:  |..|  |:|     |.|.:.:
 Worm   135 ----------------------LHV---------SSITDLMI--VSAH--HEG-----SSTESCL 159

  Fly   213 NALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAM 277
            |.       |...::..|.::.......|.| .||.|:  |..|..|:|:.|::...::     :
 Worm   160 NC-------PGVDMLDKEDVEVLLKYFKFSN-TWIDSI--FASLISPNQVELIQCDHED-----I 209

  Fly   278 AQYLMPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKS 342
            |:::               |.::..:|.             .|.|||::..||...::..:::..
 Worm   210 AKFI---------------NHSKSTLGF-------------SLSHLNLNIIEYSVFKSFCIWKLV 246

  Fly   343 PPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRF 407
            ....|....:.......|                           ..|||..|.::......:..
 Worm   247 YHETSIAMKIMAQEHFEG---------------------------VTSALRKYYRKESKMNDLEV 284

  Fly   408 QTLLGVVQLMHKVSSFTIEELFFRKTIGDITIVRLISDM 446
            .|.:|.:                  |:..||:..|.:||
 Worm   285 ATRIGDI------------------TLQIITVSNLYNDM 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 28/83 (34%)
NR_LBD 215..436 CDD:416257 30/220 (14%)
nhr-74NP_492919.2 ZnF_C4 11..78 CDD:197701 24/70 (34%)
HOLI 153..301 CDD:214658 35/235 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.