DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-245

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001366650.1 Gene:nhr-245 / 191496 WormBaseID:WBGene00014189 Length:326 Species:Caenorhabditis elegans


Alignment Length:446 Identity:84/446 - (18%)
Similarity:141/446 - (31%) Gaps:178/446 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGK---HYGIYACDGCAGFFKRS--IRRSRQYVCKSQKQGLCVVDKTHRNQCRACRL 93
            |:||  ||:.:   ::||.:|..||.||:||  ||    |:|.:...  |.:....:..|||||.
 Worm    15 CQVC--HSTERTRLYFGITSCAACAAFFRRSDGIR----YMCTATNS--CTISHDMKFFCRACRY 71

  Fly    94 RKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQ--IPAEILMNTAALTGFPGVPM 156
            ..|...|                    |.|.::|:..|.:.|.  ||.|            ..|.
 Worm    72 TSCIRAG--------------------MVMSRNALATARKAPNNIIPRE------------PTPR 104

  Fly   157 PMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALP 221
            .:|.|.:..|.              :.:|::|...:..:.|.:                      
 Worm   105 SVPSLEEVDGF--------------SKILNISNGDLLKYYVKE---------------------- 133

  Fly   222 PTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTE-------LPMPDQLLLLEE------------ 267
             ...:||.:...|.......|:||.:..|.|:.|       ...|...:|..|            
 Worm   134 -VESIMAQQRYGEQKNALQVKSVNDLMIVTAYQEGTSLESCFNCPGVDILYNEDVEVVHKYFKFS 197

  Fly   268 -SWKEFFILAMAQYLMPMNFAQLLFVYESENANREIMGMVTREVHAFQEVL-NQLCHLNIDSTEY 330
             :|.: .:||....|.|             :.|..|    :..:|..:..| :.|..||::..||
 Worm   198 NTWID-SLLAPTSPLDP-------------SCNERI----SEFIHLLKSTLGSTLAQLNLNIIEY 244

  Fly   331 ECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSSASAESRGLLESGKVAAM--HNDARSALH 393
            ...::..:::......|.                             |.|:.|.  :....|||.
 Worm   245 AAFKSFCIWKLVYHKTSI-----------------------------SMKIVAQEHYEGVTSALR 280

  Fly   394 NYIQRTHPSQPMRFQTLLGVVQLMHKVSSFTIEELFFRKTIGDITI-VRLISDMYS 448
            .|.::                       :..:.||.....|||||: :..:|::|:
 Worm   281 KYYRK-----------------------NIKMSELEMATRIGDITLQIITVSNLYN 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 26/87 (30%)
NR_LBD 215..436 CDD:416257 37/243 (15%)
nhr-245NP_001366650.1 ZnF_C4 15..79 CDD:197701 26/91 (29%)
HOLI 168..311 CDD:214658 33/212 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.