DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-242

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001343692.1 Gene:nhr-242 / 190547 WormBaseID:WBGene00022097 Length:305 Species:Caenorhabditis elegans


Alignment Length:82 Identity:34/82 - (41%)
Similarity:46/82 - (56%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |.||...:|...||..:|.||..||:|.....:::.|...:.  |.::...||.||||||:||..
 Worm    21 CAVCGGKASSSRYGALSCIGCLVFFRRMTCGEKKWYCLRNRN--CEINIATRNTCRACRLQKCLN 83

  Fly    99 VGMNKDAVQH--ERGPR 113
            ||||.:|:|.  |.|||
 Worm    84 VGMNPNAIQRRDEIGPR 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 34/82 (41%)
NR_LBD 215..436 CDD:416257
nhr-242NP_001343692.1 NR_DBD_HNF4A 21..96 CDD:143518 30/76 (39%)
Hormone_recep 105..289 CDD:306586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.