DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-236

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_500190.3 Gene:nhr-236 / 189677 WormBaseID:WBGene00021417 Length:283 Species:Caenorhabditis elegans


Alignment Length:397 Identity:92/397 - (23%)
Similarity:149/397 - (37%) Gaps:141/397 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFE 98
            |:||.|.:||:|||:.:||||.|||||||||:.:|.||  :.|.||:|.|.||||:|||.:||..
 Worm    13 CRVCGDRASGRHYGVLSCDGCRGFFKRSIRRNLRYSCK--ESGDCVIDVTRRNQCQACRFQKCIT 75

  Fly    99 VGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQ 163
            |.||:.||||||                  :||...|: |.:.|:....:.        .||:|:
 Worm    76 VAMNRHAVQHER------------------LGAPPEPK-PTQTLIKAKRIR--------KPGIPE 113

  Fly   164 RAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMA 228
                                |:|                                  |.:.|:..
 Worm   114 --------------------VID----------------------------------PISDPISC 124

  Fly   229 AEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLFVY 293
            ...:           :.|..|:......|..|:.::....|...|:.    :::..:...|:   
 Worm   125 LSAV-----------IRWWSSLPPANGFPASDRRIIFSNCWHSLFLF----HVICQSGTSLV--- 171

  Fly   294 ESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSIL 358
              .:.|.|.:..:::.:.|          ||::..|...:..|.::|        :||       
 Worm   172 --NDCNNEKLRSISKTIKA----------LNLNVVEQWAITVIIIYR--------SED------- 209

  Fly   359 TGSGSPNSSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQPMRFQTLLGVVQLMHKVSSF 423
                     ...||:....|.::.||    :....|:..|...|:..|...||.:...:.:::..
 Worm   210 ---------GRLESKSETLSTQIGAM----QILAENHAARVFQSRSTRCAQLLLIPLTIAQIAET 261

  Fly   424 TIEELFF 430
            .|.|.||
 Worm   262 EIREAFF 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 48/82 (59%)
NR_LBD 215..436 CDD:416257 34/216 (16%)
nhr-236NP_500190.3 NR_DBD_PNR_like_1 13..88 CDD:143538 48/94 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D373206at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.