DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-231

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_507672.2 Gene:nhr-231 / 189445 WormBaseID:WBGene00012449 Length:397 Species:Caenorhabditis elegans


Alignment Length:367 Identity:81/367 - (22%)
Similarity:136/367 - (37%) Gaps:104/367 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PAASSRILYHVP--CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDKTH 84
            |.|:.::.| .|  |::|:....|.|:|:..|..||.||:|::..:|:|.| :||.|.|.|. ..
 Worm     4 PCATLQLNY-TPDKCEICQKTGHGHHFGLETCRACAAFFRRTVVLNRKYKC-AQKSGKCDVG-AE 65

  Fly    85 RNQCRACRLRKCFEVGMNKDAVQ----HERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAE-ILMN 144
            :..|:.||.:||.::||..|.|:    .|:.|.:|.|.....:|..:....|....:... :|..
 Worm    66 KATCKFCRYKKCIDLGMTTDNVRAEDITEQEPASSHLPEAQILYTISSKSRGSSLLVDVNAVLRK 130

  Fly   145 TAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHG---FFS 206
            :.|:               ...:|..::|....|      |.:.|..:  |.:.....|   ||:
 Worm   131 SKAI---------------MEDNHNFYVAPDLNP------LQMMVESL--HKIRSKQSGSPEFFT 172

  Fly   207 ----------------PTAAY-MNALATRALPPTPPL-----------------MAAE------- 230
                            .||.: ||....|.||....|                 |:||       
 Worm   173 TIKFGRKFQWWAEQLEDTATWLMNCREFRGLPIHEKLAIFKIVWAVWRRFERYTMSAEVFGQKCY 237

  Fly   231 ------HIKETAAE----------------HLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFF 273
                  |..:.||.                |.|:||...|.:|.|..:..|...|.|.|: :..:
 Worm   238 DEKILLHSHKFAARFGSYCVDYSHVWSQGPHTFENVFGGKMIRYFDIIVKPYLELNLSET-EVTY 301

  Fly   274 ILAMAQYLMPMNFAQLLFVYESENANREIMGMVTREVHAFQE 315
            ||....:    |:|......:::.|....:..::..:|::.|
 Worm   302 ILCQIVW----NYAGRRLQGQTQAAGERFLEEISNNLHSYYE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 33/97 (34%)
NR_LBD 215..436 CDD:416257 28/147 (19%)
nhr-231NP_507672.2 ZnF_C4 16..85 CDD:197701 26/70 (37%)
Hormone_recep 164..373 CDD:278530 35/181 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.