DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-223

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001359598.1 Gene:nhr-223 / 188934 WormBaseID:WBGene00012050 Length:281 Species:Caenorhabditis elegans


Alignment Length:387 Identity:74/387 - (19%)
Similarity:127/387 - (32%) Gaps:130/387 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 FFKR-SIRRSRQYVCKSQKQGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRH 120
            ||:| :||:.....|...:  .|..|......|:.||.:||.|||||..|:              
 Worm     2 FFRRQAIRKCALRPCSGGE--ACYRDTPLILGCQFCRFQKCIEVGMNIKAL-------------- 50

  Fly   121 MAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVL 185
                         :.:...|.|:|..:...|......:...|::||:...::             
 Worm    51 -------------LQKTSLESLINFISDVDFERCITFLNFYPKQAGYTIWNV------------- 89

  Fly   186 DLSVPRVPHHPVHQGHHGFFSPTA----AYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNW 246
                  |.:.|:...|..  .|..    .::.|::|                          :::
 Worm    90 ------VENFPIEYIHRS--QPLNYRCWLFLTAVST--------------------------IDF 120

  Fly   247 IKSVRAFTELPMPDQLLLLEESWKEF--FILAMAQYL-------MPMNFAQLLFVYESENANREI 302
            :|...........||.::|.:.:.:.  |..|...||       .|...:.|:...:||..:|  
 Worm   121 MKKFPFVFLSNSHDQTIILRKKFVKVASFCEAFRVYLFRDKQLAFPDGSSILIEGLDSELGDR-- 183

  Fly   303 MGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPNSS 367
              :..|.|..|.|       |:|.:.|: .|..:.||                          |:
 Worm   184 --IKYRLVVTFFE-------LHITNEEF-LLLLVLLF--------------------------SN 212

  Fly   368 ASAESRGLLESGKVAAMHNDARSALHNYIQRTH-PSQPMRFQTLLGVVQLMHKVSSFTIEEL 428
            .:.||.....|..::|..|...|:|..|...|: .:.|.||..||.|.|::.. ..|.::|:
 Worm   213 PAIESLSQTGSRLLSAYQNYYSSSLLEYCMLTYLKNGPTRFAELLDVFQVLTN-PEFQLDEI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 19/60 (32%)
NR_LBD 215..436 CDD:416257 43/224 (19%)
nhr-223NP_001359598.1 NR_DBD_like <2..49 CDD:383039 18/48 (38%)
HOLI 110..265 CDD:214658 42/218 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.