DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-127

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001370055.1 Gene:nhr-127 / 188480 WormBaseID:WBGene00003717 Length:355 Species:Caenorhabditis elegans


Alignment Length:337 Identity:69/337 - (20%)
Similarity:121/337 - (35%) Gaps:94/337 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQKQGLCVVDK 82
            :..||..|      :||:||::.|:|.|:.:.:|..||.||:||:....:|.||..|: .|.:..
 Worm     3 ITFSPELS------IPCEVCKNQSNGYHFEVLSCGACASFFRRSVVSKIKYQCKDGKK-RCQIRY 60

  Fly    83 THRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQ-----IPAEIL 142
            ..|:.||.||..||.:.||..:.:|..|.                 :.:...|.     ||:::|
 Worm    61 LDRHFCRYCRFSKCVKAGMKAEKIQKNRD-----------------LDSSPTPTDQNNCIPSDVL 108

  Fly   143 MNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSP 207
            .:...|.      ..:.||          ...|.|                 |...:|.......
 Worm   109 HDDGILI------KDIRGL----------FKQFNP-----------------HNASEGCSKLEKL 140

  Fly   208 TAA--YMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWK 270
            |..  ::.....|........|.:|.:|:...:.:.....|:.....|.:|...:::::||..|.
 Worm   141 TEGLQFIRRNQERECIKIIDEMDSESLKDVQFKVIGSCATWLLFSSFFQKLEENEKVVILERLWH 205

  Fly   271 EFFILAMAQYLMPMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRA 335
            .:.:|                  |..:.:.||.|         .:|:::......|:|   .:|.
 Worm   206 GWTVL------------------EFLSRSLEIFG---------NKVIDEKIVFISDNT---AIRL 240

  Fly   336 ISLFRKSPPSAS 347
            |:.|..|..:||
 Worm   241 ITAFENSLKTAS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 31/91 (34%)
NR_LBD 215..436 CDD:416257 24/133 (18%)
nhr-127NP_001370055.1 ZnF_C4 12..82 CDD:197701 28/70 (40%)
Hormone_recep 156..352 CDD:395054 23/127 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.