DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-210

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001350970.1 Gene:nhr-210 / 187830 WormBaseID:WBGene00020015 Length:403 Species:Caenorhabditis elegans


Alignment Length:305 Identity:70/305 - (22%)
Similarity:117/305 - (38%) Gaps:51/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CKVC-RDHSSGKHYGIYACDGCAGFFKRS----IRRSRQYVCKSQKQGLCVVDKTHRNQCRACRL 93
            |||| .:...|.|:|...|..||.||:|:    :|.|:   |:|..   |..:|:.   |:.|||
 Worm     4 CKVCTAEGCHGTHFGTICCRACAAFFRRTAFSKLRNSK---CRSAS---CDKEKSF---CKPCRL 59

  Fly    94 RKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPM 158
            |||.||||.....|:.|...:.:  ...:::|  .:.|....|..::|..:.....|.||:.:..
 Worm    60 RKCLEVGMETSNFQYHRDSLHDS--ESSSVFK--KLEAKHSKQTISKIPKSFECFVGRPGMILFW 120

  Fly   159 PGLPQRAGHHPAHMAAFQPPPSAAAVLD--LSVPRVPHHPVH----QGHHGFFSPTAAYMNALAT 217
            ..  |::.|....:       ..:.:||  ..:.|.|...||    |.|...........|....
 Worm   121 DA--QKSKHRKTFI-------DVSYLLDEATMIFRQPSENVHIFENQLHRLAIGLKVVSGNTKNY 176

  Fly   218 RALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLM 282
            |.|..    :....:.:|..........|:...:.|..|....:|.||:.:|..:.:|       
 Worm   177 RFLTK----IDQRELSDTWQWQFLTVAKWLTHFKQFDALEEKVKLTLLQSTWHVWSVL------- 230

  Fly   283 PMNFAQLLFVYESENANREIMGMVTREVHAFQEVLNQLCHLNIDS 327
            ..:||..  .:...|.|......|||     :.|:..:.:::.|:
 Worm   231 DHHFASA--AHHRSNPNALKTHAVTR-----RGVMMDMTNVHFDA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 32/87 (37%)
NR_LBD 215..436 CDD:416257 20/113 (18%)
nhr-210NP_001350970.1 ZnF_C4 4..67 CDD:197701 28/71 (39%)
Hormone_recep 172..383 CDD:306586 21/115 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.