DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and dpr-1

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_506457.2 Gene:dpr-1 / 187759 WormBaseID:WBGene00001062 Length:356 Species:Caenorhabditis elegans


Alignment Length:356 Identity:78/356 - (21%)
Similarity:132/356 - (37%) Gaps:98/356 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGK-HYGIYACDGCAGFFKRSIRRSRQYVCKSQK 74
            |||. ||.:.:..|.:       |.||....:.: |:|...|..||.||:|::....|||||...
 Worm     1 MDQS-NSDQTNEVART-------CLVCTITENVRFHFGSTTCLACASFFRRTVSLKIQYVCKQSN 57

  Fly    75 QGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPA 139
            .  |:|....|:.||:||.:.|.:.||..:.|   ||.|:.   ..:..|....|..|:...:..
 Worm    58 N--CIVSHAVRSGCRSCRFQNCLKSGMKTNMV---RGKRDI---NKVPKYIRESMQQGDNMTVRN 114

  Fly   140 EILMNTAALTGFP-GVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPR-VPHHPVHQGHH 202
            ........|.||| ...:.:|.:.:.|    .::....|.......|||:... :|...:|    
 Worm   115 YTTSTLETLHGFPKQEELELPVVKEDA----PNLLIVSPDQLLDYYLDLNEKEPLPLSKIH---- 171

  Fly   203 GFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEE 267
                     :|.|.        .|....|::   :|.:.||            .|..| |:..|:
 Worm   172 ---------LNTLG--------QLNQQNHVE---SEFICKN------------CPGTD-LISTED 203

  Fly   268 SWKEFFILAMAQYLMPMNFAQLLF------VYESENANREIMGMVTREVHA-------------- 312
            .      :.:.||   :.||.|..      ::..:..:::.:      ||.              
 Worm   204 K------MILIQY---VKFANLWLDALWDELHAKDKQDKQNL------VHCGEFADYDRLFSTFI 253

  Fly   313 ---FQEVLNQLCHLNIDSTEYECLRAISLFR 340
               ::.|...||:||:|..||..|::..:::
 Worm   254 SNLYESVGQFLCNLNLDIVEYSALKSFVIWK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 30/92 (33%)
NR_LBD 215..436 CDD:416257 26/149 (17%)
dpr-1NP_506457.2 ZnF_C4 15..85 CDD:197701 26/78 (33%)
HOLI 190..338 CDD:214658 22/123 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.