DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tll and nhr-208

DIOPT Version :9

Sequence 1:NP_524596.1 Gene:tll / 43656 FlyBaseID:FBgn0003720 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_506034.2 Gene:nhr-208 / 187662 WormBaseID:WBGene00011099 Length:410 Species:Caenorhabditis elegans


Alignment Length:480 Identity:98/480 - (20%)
Similarity:184/480 - (38%) Gaps:127/480 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DMMDQKYNSVRLSPAASSRILYH-VP--CKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVC 70
            |...|:.:|..:..:.|.:...| :|  |::|.:.:.|.||.|.:|:||..||:|::...||..|
 Worm    15 DQRSQESSSYSILTSTSIKCPRHNLPSKCEICGNPAIGYHYDIASCNGCKAFFRRTVITGRQVAC 79

  Fly    71 KSQKQGLCVVDK--THRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDA---MMG 130
            |  |.|.|:.::  .:|..|..||..||.:||||..|::.|.......|:..:...::|   :|.
 Worm    80 K--KWGTCLEEEIPINRRICPGCRFSKCVKVGMNPRAIRAEISSNGEILKNQLLKNREADKLVML 142

  Fly   131 AGEMPQIPAEILMNTAAL----------TGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVL 185
            :.:..:....|.::..:|          :.:|........:.:....||              :|
 Worm   143 SPKTAEDDLSISISKLSLIENKIDDLFNSKWPSNYCDWRTVTEILKAHP--------------IL 193

  Fly   186 DLS-VPRVPHHP--VHQGHHGFFSPTAAYMNALA----TRALPPTPPLMAAEHIKETAAEHLFKN 243
            ::| :|.:...|  :...|.||     |:..:||    |:.|...|.| :.:.:::.....||..
 Worm   194 EMSKIPNLSFQPNQLFPDHAGF-----AHNASLAALEFTKMLDIFPKL-SIDTVQKLVRHGLFMC 252

  Fly   244 VNWIKSVRAFTELPMPDQLLLLE--------ESWKEFFILAMAQYLMPMNFAQLLFVYESENANR 300
            .:.:.|.|:..:. ..|.|...:        :||...::                       .:|
 Worm   253 GSMMTSRRSIQKF-NSDTLRRTDGTISGKPAKSWNGVWV-----------------------DHR 293

  Fly   301 EIMGMVTREVHAFQEVLNQLCHLNIDSTEYECLRAISLFRKSPPSASSTEDLANSSILTGSGSPN 365
            :|:          |.||.....:.::..||..|:.|::..   |:.|   ||             
 Worm   294 KIV----------QRVLRAFLRIKLNDVEYLFLKVITILN---PAVS---DL------------- 329

  Fly   366 SSASAESRGLLESGKVAAMHNDARSALHNYIQRTHPSQ--PMRFQTLLGVVQLMH----KVSSFT 424
               .|:.:.::|..:     |.....|..|..|.:...  |.||.::|.::..|.    :..||.
 Worm   330 ---FAQDQKIIERER-----NRFAQCLLTYCLREYAENNGPSRFASVLSIISSMELQQKEEKSFN 386

  Fly   425 IEELFFRKTIGDITIVRLISDMYSQ 449
            |   ..|.:..|..:  |:|.::.:
 Worm   387 I---LLRASFPDAIV--LVSPLFDE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tllNP_524596.1 NR_DBD_TLX 25..117 CDD:143537 34/96 (35%)
NR_LBD 215..436 CDD:416257 42/238 (18%)
nhr-208NP_506034.2 ZnF_C4 42..112 CDD:197701 28/71 (39%)
HOLI 216..376 CDD:214658 38/221 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.